Conserved Protein Domain Family
DUF2633

?
pfam11119: DUF2633 
Protein of unknown function (DUF2633)
This family is conserved largely in the Bacillaceae family. Several members are named as YfgG. The function is not known.
Statistics
?
PSSM-Id: 402613
View PSSM: pfam11119
Aligned: 2 rows
Threshold Bit Score: 84.6216
Threshold Setting Gi: 123721212
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012131276  9 KRHRFNSRMTRIVLFISFLFFFGRFVYSSIGAWHHHQDkKEAQQSTLSVETPAQ 62  Citrobacter
Q7CJK3        9 MRRRPSTQLTKIILLVSFLILFGRLLYAAIASISHHQE-RQSQQIELSVEGEPP 61  Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap