4P0T


Conserved Protein Domain Family
CENP-M

?
pfam11111: CENP-M 
Centromere protein M (CENP-M)
The prime candidate for specifying centromere identity is the array of nucleosomes assembles with CENP-A. CENP-A recruits a nucleosome associated complex (NAC) comprised of CENP-M along with two other proteins. Assembly of the CENP-A NAC at centromeres is partly dependant on CENP-M. The CENP-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival.
Statistics
?
PSSM-Id: 402609
View PSSM: pfam11111
Aligned: 16 rows
Threshold Bit Score: 240.274
Threshold Setting Gi: 156227597
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4P0T_A         8 VLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKE--DCASELKVHLAKSLPLPSSVN--RPRIDLIVFVVNLHSKYSL 83 
Q1T7B9         3 VLRPFDKLPELNSATILLVGAEGGPQQQLAEAMLRE--KKDFNINIHLASSLPLPSERDhlRPRIDLIAFVIDIKSKYSL 80  chicken
XP_005039726   3 VLRPFDKLPMLNSCVILLVGSDEAIQQKLAEAMLQE--KRNFNVSIHLATSLPLPSERDhlRPRIDMVVFMIDIKSKYSL 80  Collared flycat...
AAI35575       3 TLRPFDKMPMLNAAALLLVGTEESHREQLASAMLKE--PKTFEVKIHMAQSLPLPYEREhlRPRFDMVVFLINLHSQFSL 80  tropical clawed...
XP_006011016   3 VLKPFDKLPELNTATVLLVGAEEHYLEKLAEIIAKE--TQPFKINVRTAKRLPLPTENDyiRPRIDLIVFIINLHNKQSL 80  coelacanth
XP_003447922   3 LLKPFSKLPGLNTANILLVESEEQFQQSLADALVE---ETSVTVNVRLAKSLPLPMENDesRPRIDLVVFIINLTSELSF 79  Nile tilapia
Q7ZZC6         3 LLSPYSKVPELNTATVLLVENEEELQNKLANAIVQH--EKDFNVNVRLAKKLPLPVENKeaRPRIDLIVFIVSLLSERSL 80  zebrafish
EDO48400       6 VLSRFGKLPTKDHGTALFVGIKGIGKHRLAQTINEC--NTEFPLQIRTATALPLPNDHQnlRPRIDYVTFFIDLENKLSF 83  starlet sea ane...
EEN51762      17 ILKPFNKMPVRNAATVLLVGSYGTGKKQLAKSMVDVctDTGLKLQVRTTTSLPLPEENTdtRPRIDYIAFIIDLTNRLSF 96  Florida lancelet
XP_016282928  21 LLRPLDKLPTLDVATILLVGAEEKLLEQLGEAVLREg-EGSAKVQVHVAPGLPLPADREclRPRVDLVVFVLSLHSKHSL 99  gray short-tail...
4P0T_A        84 QNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEV--EGFRATMAQRLVRVLQICAGH 161
Q1T7B9        81 KNVQASLAYVDVRFFLGKVCFLVTGVGRANNCSVEMNAIWKLGEDYCSPVIFCELEL--EGIRVATAQRLLRMLQICAGR 158 chicken
XP_005039726  81 KNVETSLAHVDASFFLGKVCFLVTGVGRVNACSIETNAVCKLAEAYCSPVLFCELEL--EGVRAATAQRLLRMLQICAGH 158 Collared flycat...
AAI35575      81 STVLASLTHLDVNFFLGKVCFVAIGGGQVKHCMVDIATVKKLADTHLSTLLFSEFDS--EDDVTCTARRLLQMVQICAGL 158 tropical clawed...
XP_006011016  81 SVVESALAFVDVKFFLGKVCFLATGVGMVKYCSVEAYSVRKLAESCCCPVIYTELES--RKERESTAQRLVRMLKISAGF 158 coelacanth
XP_003447922  80 QSAEASLKYLDPGYFLGKVCFMVTNARNASSPAERLDAVRKLASSLHCPLLFAEDQT--PDGVASATERLLTILKVAAGL 157 Nile tilapia
Q7ZZC6        81 QSAESSLSHLHSDCFLGKVCFLVTDARCGSHTQERLVSVRKLAASHHCPVICAEHRT--ADGVSAAALRLLNILQVSAGM 158 zebrafish
EDO48400      84 DVVKLSVKSLAVDYFLGRCCFILTNAKKEECNNVDIQDVIEFANS--------------KDGQRCLAQKLLQRIKPACGY 149 starlet sea ane...
EEN51762      97 STVQSAVQCVDVEYFLGRACFVVTNVKGTSDHCVEMEEVSRLADMYNTMYICGGIKEgdPDERTTLANRLLQLVEVSAGR 176 Florida lancelet
XP_016282928 100 RTVEASLPQLDAGFFLGKVCFLASGVGSEQKASIHTDAVARLAATFRSPLLFGDLEV--EPSRLSVARRLLRVLQICAGH 177 gray short-tail...
4P0T_A       162 VPg-VSALNLLSLLRS 176
Q1T7B9       159 VPg-VSALYFSLLMRN 173 chicken
XP_005039726 159 IPg-VSALSLVSLMRN 173 Collared flycatcher
AAI35575     159 VPg-ISALYLGSFMNS 173 tropical clawed frog
XP_006011016 159 VPg-VSALFFSSLLKT 173 coelacanth
XP_003447922 158 VPi-ATALYVSNLTRC 172 Nile tilapia
Q7ZZC6       159 TPmsTTALYLSTLTRC 174 zebrafish
EDO48400     150 HGd-VTPLLLDTTRQI 164 starlet sea anemone
EEN51762     177 KN--VSPLLVDLTCRQ 190 Florida lancelet
XP_016282928 178 VPg-lSALNLLSMMKR 192 gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap