Conserved Protein Domain Family
RFamide_26RFa

?
pfam11109: RFamide_26RFa 
Orexigenic neuropeptide Qrfp/P518
Qrfp/P518 has a direct role in maintaining bone mineral density. Qrfp has also found to be important in energy homeostasis by regulating appetite and energy expenditure in mice. The c-terminal 28 residues are the functional 26RFa.
Statistics
?
PSSM-Id: 402608
View PSSM: pfam11109
Aligned: 15 rows
Threshold Bit Score: 130.179
Threshold Setting Gi: 444519249
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003407599   5 YPLSYL-LLLPLGVCFPLADREESGDTLGGIRA-KTSWAHLAQWHrpNFRWGSSWQPRAPQPLALLVVAKELQTSGKERA 82  African savanna...
P83862         5 YSLPYL-LFLPLGACFPVLDTEEPVDAVGGTGR-EMSWMDPARGR--PFPWGSPGWPRAPYPHALLVTAKELRASGKARA 80  cattle
XP_003122292   5 HSLPFL-LLLPLGACFPVLDRDVPVNAMDVVGG-GRSWANLAGGR--HFLWGSPGWQRAPHPGAWLIMAKELQAVGRARA 80  pig
XP_023602403  45 hlLSCL-LLLPLAACFPLPDREAPMDTTGDTGG-GMSWADLAGGHvaHFP----RRLRAPHPQALLAMAKELQMSGRARA 118 little brown bat
XP_012914087   5 RALPCL-LLLPLGACLPLLDREEPAATVGGVRG-GMSWADLPGGYrmLPPRGSPGWPGAPQPHGLLVMAKELQVSGQRRP 82  domestic ferret
XP_850751      5 RSLSCL-VLLPLGACFPLLDREEPVAAMSGVGG-EMSWANLPGGHraPLPRGSSRWLRAPHPHGLLVTAKELQMSGRQRA 82  dog
XP_007475223  10 HSLSCL-LFLTLGACFPPSDKREIGDPVDGMGKvQMRGAKMAEGHwpGFLKGTPKWKRFQDPSSLFVMAKKLQGLGKERA 88  gray short-tail...
ELV12687       5 cSLAYL-LLLPLGTCLPLLDMREPADAGPGMAA-EKTRAALAEAGlpYVVQGPSQGSSIRKPLTRLVLTEELQEDNRGRT 82  Chinese tree shrew
EGW00429       5 HTLPYL-LLLPLSTCFPLLDRRGPTD-IDDIRA-KMSWANPVEERrpHSVQDPFLWLRVPQPQALLVVAKELQSSHREHT 81  Chinese hamster
Q8CE23         3 GFRPLLsLLLPLSACFPLLDRRGPTD-IGDIGA-RMNWAQLAEGHppNSVQN-------PQPQALLVVAREQQASHREHT 73  house mouse
XP_003407599  83 GFRFRFGRQ-DDGDEATRFLPADGEKTSGPLGSLAEELTGYSRKKGGFSFRFGR 135 African savanna elephant
P83862        81 GFQLRLGRQ-DDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRFGR 133 cattle
XP_003122292  81 SFGLRFGRQ-DNGSEAAGFLPGDGEKASGLLGTLAEELHGYSRKKGGFSFRFGR 133 pig
XP_023602403 119 GFGLRFRRQ-DDGLGEAGSLLADGKKAGSQLGTLADEISGHNKNKGGFHFRFGR 171 little brown bat
XP_012914087  83 GFTFRFGRQ-DDGSKATGFLPADGEKASGPLGTLAEELSSYSRKKGGFSFRFGR 135 domestic ferret
XP_850751     83 GFRFRFGRQ-DDGSEATGFLPADGEKAHGPLGTLAEELSSYSRKKGGFSFRFGR 135 dog
XP_007475223  89 GFRFRFGRQ-EEDSKATNIYPASEEKQNSLLGSLAEELSGYIRKKGGFSFRFGR 141 gray short-tailed opossum
ELV12687      83 DLEARFGRQaDGGRKGTG------KKSNELLDKLAQSFKAYTRQKGGFWFRYGR 130 Chinese tree shrew
EGW00429      82 GF--PPGRR-DRSSQAAGFLPTDAEKASRPLGTLAEELSSYSRRKGGFSFRFGR 132 Chinese hamster
Q8CE23        74 GF--RLGRQ-DGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRFGR 124 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap