Conserved Protein Domain Family
DUF2887

?
pfam11103: DUF2887 
Protein of unknown function (DUF2887)
This bacterial family of proteins has no known function. These proteins may be distantly related to the PD(D/E)XK superfamily.
Statistics
?
PSSM-Id: 371375
View PSSM: pfam11103
Aligned: 100 rows
Threshold Bit Score: 175.393
Threshold Setting Gi: 557037593
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Chro_5316              31 TDSLFYEIFQTDPSIVFELIGNLSARNITYSFASQEVKQTSFRIDGILVPPIYA-TDLPIVFVEVQGYKDSKkvLYSSFF 109 Ch...
ESQ14613                    3 TDQAIYTYLKTGTEAFRILTG-GMQLIGPYRFRSITLKALERRSDGVCEPDPG--HPGPVYVIEFQAQPTQT--AWYNLL 77  un...
jgi:Thivi_2135              3 TDSSIYTFLATGPEAFRVLTG-GLTLEGEYVFRSVTFKSLERRADGLYEPLD---PDRPVYLIEFQAQSAAA--AWYNLL 76  Th...
ASGPB:GKIL_4351             3 TDALLYDLFQTFPALFFELIGRDIALAEQYRFDSIEVKQIAFRLDGVFIPEDTA---QPLYFLECQFQRDQA--IYLRLF 77  Gl...
WP_014273938                3 TDKLFYRIFLWQPELIAELVP-GIPMDCQFDYSAPVVKEQEQRIDGLFTPVGDDnPDLPLVFVEAQMQPDRG--FYGRFF 79  Ar...
WP_015124543                3 TDKLFYAIFLFQTRLITELIP-GLPANCEFEYSAPVVKESEYRIDGVFTPVAED-PGLPIVFIEAQMQPDAG--FYGRFF 78  Sy...
jgi:Syn6312_3415            5 TDKLFYAIFLFRTRLLSELIP-GLDPTCEYEYTAPVVKATEYRLDGVFTPLEPT-LEQPVVFVEAQMQSDPG--FYGRFF 80  Sy...
WP_015218926                3 TDKLFYQIFINQPSLINELLP-EIPSNCQFEYTAPVVKDTEFRLDGLLTPLSDD-KNIPLVFLEAQMQKDIK--FYHRYF 78  Cy...
dbpsupku:SYNPCC7002_A0420   3 TDKWFYELFLSQPGMLAELIP-GIDPDWEFVYSAPVVKEKEFRLDGLFLPVTEK-PGIPIVFAEAQMQADER--FYGRYF 78  Sy...
P74675                      3 TDKWFYELFLSQPGMMAELVP-GIEPEWEFVYSAPVVKEKEFRLDGVFMPVSED-PLVPIIFAEAQMQADEQ--FYGRYF 78  Sy...
jgi:Chro_5316             110 SQIFLYLHDYQPVNDWQAILVFTRRSLDPGLPR---QYRVFASSSQFQRIYLDELGETENLSLGLSLLQLIGLRQEVASE 186 Ch...
ESQ14613                   78 TKLGLLGEELGG-VEIVGILIFLHEQDDPRHPTgitAPGAPFRAVYLNRFLPDLLVQQPDNPYIAVLAPLVIERDEELKA 156 un...
jgi:Thivi_2135             77 TKIGLYGEEHPE-REVRGLLIVLHARALPTRPSrvgAPESIAAAICLERFLPEWLEREPDNPFLAALAPLIITRDAALTE 155 Th...
ASGPB:GKIL_4351            78 AQLALYFRRKRFLGDWQAVVLFATQSMDPGVPR---AYRAFEASGQVRRFYLTE--QVEQGSLAFEILGMLRTPKRKFKA 152 Gl...
WP_014273938               80 REVFMYLGQYEVSRPWRGLLIFPSRSQGFGVET---PYRLLLDNL-VERLYLEDLIGRSDLSPNLALLRLLVLPESETPE 155 Ar...
WP_015124543               79 AEVHVYLHQYQVIRPWQGLLILASRQHELGVDV---PYRLYLEQQ-VQKLYLEDLATATDLSPGQALLQLIVIEASQTPQ 154 Sy...
jgi:Syn6312_3415           81 AEIYRYLHQYQVERTWRGLLILQSRQQRLGNAR---PYLEPLDQQ-VKSIYLEDLAAADSLSPTLRLLQLLVLDASVTVP 156 Sy...
WP_015218926               79 AEIFLYLSQYEIKRPWKGLLILKNKNNDLGSEV---PYQILLNNN-ITRLYLEELSNIEKLSPNLALLRLIVSPNSEIKH 154 Cy...
dbpsupku:SYNPCC7002_A0420  79 AQLFVYLYQYNVDCDWRGLLILRGRRQGLGSEL---PYQGLLEQR-VTRLYLSDLKDKADLSPNLMLLQLLTTEKLQSMQ 154 Sy...
P74675                     79 AQLFVYLYQYRVSRDWRGLMILQSREQRLGNDL---PYRDLLAQR-VTRLYLSDLRTGEASSPNLALLQLLVADKNKTLE 154 Sy...
jgi:Chro_5316             187 RGRRLVGRIRRELTDAGNQRKFIELVETVFVYKFPDLSREEIEAML 232 Chroococcidiopsis thermalis PCC 7203
ESQ14613                  157 QAPRLWQVIQSAPIPEPIRRNLAEILEFWFMERFSDLTPEEVFNML 202 uncultured Thiohalocapsa sp. PB-PSB1
jgi:Thivi_2135            156 RAPALWHAIQHAPLEPAARTALSQILEFWLFERFRSLTAEEISTML 201 Thiocystis violascens DSM 198
ASGPB:GKIL_4351           153 KIEEMLSKVRAEPLSADQQQQIMGMFATVLAAKFPELSRREIEAML 198 Gloeobacter kilaueensis JS1
WP_014273938              156 SARDLLNVEASEEVFRR----RLDLVESILVSKFPQLSLEEIREML 197 Arthrospira platensis
WP_015124543              155 AAQNLIQSLANTSDFTQ----WLDLIEAILGNKFPDLNLEEIRKML 196 Synechococcus sp. PCC 6312
jgi:Syn6312_3415          157 AAQSLLESVASESDFNQ----WLDVVEAIVISKFPDAGLEGVRAML 198 Synechococcus sp. PCC 6312
WP_015218926              155 LGNLVLSSAKTEEDFQR----QFTLIEAILKSKLPQLKTEDILTMF 196 Cyanobacterium aponinum
dbpsupku:SYNPCC7002_A0420 155 LGQTLLKTAETEAEFDR----RLSLIETILTNKYPDLTQEMIMEIL 196 Synechococcus sp. PCC 7002
P74675                    155 LSKGLLRSAPTDNEFQR----RLSLIETILANKFPDLTKEIIMQML 196 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap