Conserved Protein Domain Family
Alveol-reg_P311

?
pfam11092: Alveol-reg_P311 
Neuronal protein 3.1 (p311)
P311 has several PEST-like motifs and is found in neuron and muscle cells. P311 could have some function in myo-fibroblast transformation and prevention of fibrosis. It has also been identified as a potential regulator of alveolar generation.
Statistics
?
PSSM-Id: 402599
View PSSM: pfam11092
Aligned: 6 rows
Threshold Bit Score: 106.798
Threshold Setting Gi: 1040118801
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q80Z34        3 YYPELLVWVSQEPFPYKEMEGGLTKGRLPVPKEVNRKKMDEPIAASLI-PPGNHEPGSPAIGYLHPF 68  Norway rat
2_pfamImport  1 CHPKLTVWIGQDSFPTNQEDERFLKENLPVPREVNRKKQDEIAATSLIlLSGSDGQYSTRINYLYSF 67 
XP_017193121  3 DCQDVSVGVSQGPAANQGLEGRLPEGGLPVPKEVNRKKMAGTSAASPT-PPGGHGLRAPGVSYRHSF 68  rabbit
XP_003638998  3 CYPELSVWVSQEPFPNTEMEGRLPKGRLPIPKEVNRKKDDQMKVASLT-PPGSSELHAAGTSYLHSF 68  dog
Q90667        3 YQPRQTIWVSQKVFPTSQGDGGFLKGCLPISKEVNRKKESEVEGACWA-PVNGDGHHFTKINYLYTF 68  chicken
OWK57404      3 YQPGSMIWISQKIFPTSRGDGGFPKGNLPVSKEVNRKKSEA-EGACLA-PTSGYGQHFSKINYLYSF 67  Bengalese finch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap