2LLZ


Conserved Protein Domain Family
GhoS

?
pfam11080: GhoS 
Click on image for an interactive view with Cn3D
Endoribonuclease GhoS
GhoS is part of the GhoT-GhoS type V toxin-antitoxin (TA) system. GhoT is inhibited by antitoxin GhoS, which specifically cleaves its mRNA.
Statistics
?
PSSM-Id: 402595
View PSSM: pfam11080
Aligned: 7 rows
Threshold Bit Score: 129.091
Threshold Setting Gi: 502966924
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LLZ_A        10 NTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDIDFDLNIM 89  Escherichia col...
WP_013201900   7 TQYVVTFRYQEEGLSDVLELNSVLTNGGFSTSLTDADGTSHQLGTNSFGITSPQDKDQIHEQAEKLAEVALGQKPEVEVQ 86  Erwinia billingiae
ACR68916       7 ACYIVHFTALPNDDAVHAELRRVLQHAGFATIVADVDGIPHHLAADCYALTSVQDKSDVERLAQALGQQALGQTPQVEAL 86  Edwardsiella ic...
WP_015958607   6 TAWVVSVTFHEQALTEINEVSNHFTRAGFVLTLNDEEGTPHELGTNTFGLLSGQTAEEVKALSAGLAEAALGRPAEIAVA 85  Klebsiella pneu...
Q8ZPT6         7 TRYVITVTFHEDSLTEINELNNHLTRSGFLLTLTDDEGDVHELGTNTFGFVSAQSADEIKALVAGLAKSALDKDVDITVA 86  Salmonella ente...
P64479         7 VRYVITVMLHEDTLTEINELNNYLTRDGFLLTMTDDEGNIHELGTNTFGLISTQSEEEIRELVSGLTQSATGKDPEITIT 86  Escherichia col...
WP_012132615   7 IRYVITVKFHEDSLTEINELNNHLTRCGFLLTMTDEQGHVHELGTNTFGFISALSEDEIAALTAGLAESALDKKPEISVM 86  Citrobacter
2LLZ_A        90 TVDDYFR 96  Escherichia coli K-12
WP_013201900  87 TFEAFLQ 93  Erwinia billingiae
ACR68916      87 LCEEYFt 93  Edwardsiella ictaluri 93-146
WP_015958607  86 TFTEWLK 92  Klebsiella pneumoniae
Q8ZPT6        87 TWEAWSK 93  Salmonella enterica subsp. enterica serovar Typhimurium
P64479        87 TWEEWNS 93  Escherichia coli K-12
WP_012132615  87 TWEEWTK 93  Citrobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap