Conserved Protein Domain Family
YqhG

?
pfam11079: YqhG 
Bacterial protein YqhG of unknown function
This family of putative proteins is conserved in the Bacillaceae family of the Firmicutes. The function is not known.
Statistics
?
PSSM-Id: 402594
View PSSM: pfam11079
Aligned: 17 rows
Threshold Bit Score: 389.721
Threshold Setting Gi: 407727288
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABV62860         1 MEQRDIHTFLLRFFQANQCDILEESTGHMTVQLTIEMDKLIMNRPFYWHWLEKTGGVPEPRQLTLITDQKKVDDTIEGEF 80  Bacillus pumi...
Q65HF6           1 MRQEEIYLFLERFFTANGCTITDKSPGHMTVQLTVEVDKQIMNRPFYWHWLEKTGGEPNPMKITLITNEDEAPSDIEGEF 80  Bacillus lich...
P54508           1 MRQQEVHDFLLRFFQANSCQIVDQGLGYMTVQLTVEMDKQIMNRPFYWHWREKTGGDPNPMKITFITDKENAPKDLDGEF 80  Bacillus subt...
Q9K932           1 MQQEQLHQFLTRYFEANDSPLIDSSPYHLTVQLSIDMDKRLMNRPFYWHYLEKTGGIPQPMQMTLVTDPEKAPDDLKGEA 80  Bacillus halo...
WP_012959683     1 MQQQQIHNFLERYFEANDSPVLENTPAYLTVQLSIELDKLLMNRPFYWHYLEKTGGTPNPMKITFITDKANAPDDLRGEP 80  Bacillus pseu...
Q5WF28           1 MRPPDIHQYLRRYFLANDSPILEESPSHLKVQLSVELDKELMNRPFYWHYLEKTGGVPNPMTLTLITDNNRCPEGIKGEP 80  Bacillus clau...
tigr:GBAA_4451   1 MQQHEIHNYLYNFFEANNCEILERSPHLLDVQLTIEMDKLLMNRPFYWHYLEKTGGVPNPMRLTLITDPENEEND--GEL 78  Bacillus anth...
jgi:Bcell_1684   1 MDQLEIHNYLKQFFTENDSTIIDESKGHLHIQLSIDMDKALMNRPFYWHYTEKIGGVPNPMKLTLITNSNEAPTDLKGEL 80  Bacillus cell...
Q8EQ20           1 MAIHDLNTFLSDYFETKNCSIEENSDGKMVIQLTEEMDRELMNRPFYWHYIKKIGRQGEPMKLSMITNLDRKDE--QGEW 78  Oceanobacillu...
BAM47286         1 MQIENLHDFLVDYFTASQCQV-EVINDTISIQLTEEMDERLMNRPFYWHYVRKLNQTGQPLQLKITTNHSSATKEI--DY 77  Amphibacillus...
ABV62860        81 IHFGSPRLFQIFEAVKQQGRFIRLYEQVTPlMKNQIALEPWLGLNVKISYLADRKKDKLLSLGLHLIRGEVVEQFQEKLE 160 Bacillus pumi...
Q65HF6          81 IHFGSPRLFQIFQAVQKNGKFIRLYEKIRS-EGAHIPLEPWLGMNVTISYQSDMKKDKLLSLGLHLISGQLTESFQEQME 159 Bacillus lich...
P54508          81 IYFGAPRLFQIFKAVKQNGRFTRMYEKIES-AGAKVPLQPWLGINVTISYQSDMKKDKLLSLGLHLVSGTIIEDFQSKLT 159 Bacillus subt...
Q9K932          81 IHFGAPRLHQIFQSTRELGGFLHLYENVPTtGQRSVPLHPWLCLNAKISYQCDRKKDVFLSLGLNLIHGQIVQSFFPKLE 160 Bacillus halo...
WP_012959683    81 IHYGSPRLHQLFKSTRTLGGFIRLYEQVATnGHASTPLQPWLCLNVKVSFQCDRKKDVILSLGLNLIHGQIVPGFYDSIE 160 Bacillus pseu...
Q5WF28          81 VHFGSVRLAQIFQSAKKLGAFVRMYEQKQPvGQSSHPLHPWLCMNANVAFQCDRKKDVLLSLGLNLIHGQIVPQFFERLE 160 Bacillus clau...
tigr:GBAA_4451  79 IHYGSPRLHQIFQTTKELGSYIRLYEDVRHnGATHTPLHPWLGINIKVSYQCDRKKDILHSIGIHLISGTMMANFHDTLT 158 Bacillus anth...
jgi:Bcell_1684  81 IHFGSPRLHQIFQTAQDRGSHAVLYESIDT-NGTSTPLKPWLIINGSVSYRCDHKMDQFFSIGLSLITGEMIHDIHAKIE 159 Bacillus cell...
Q8EQ20          79 IHFGSPRLHQILNKLKQGERLTKLFEVIHT--TEKTPLYPWLITNIKVSYSGRYNKDEILSMGLQLVNGRMIVDAMDKLQ 156 Oceanobacillu...
BAM47286        78 IYYTTDRFQKIAEDTIIKGRYCKLYENIRP--TKQTPLYPWLVINIKQTYLGKKQAEQLLSLGINLINGTIIDQAIFMLK 155 Amphibacillus...
ABV62860       161 TRELSSQIPDYCFTMSTMIKPESGVKRLYSLMEHYAHEEPDDWAVRAVQKWKEDTELLNQFYEGTSDTSVE-YEIERQAL 239 Bacillus pumi...
Q65HF6         160 ARELSSQISDYCYTMSPLIKPESGIKRLERYIEQAARSEPLDWAEASLKRWNNDLALLNQFYEDTEEKPEE-YEIEKKAL 238 Bacillus lich...
P54508         160 QFSLTSQICDYCFTISPMIKPESGLKRMENYISKSAMQEPSDWAEQAVNRWKNDMTLLDKFYEHIEEKPEE-YHLEKQAL 238 Bacillus subt...
Q9K932         161 STSFSYKTPDYCFTLSPLITPQSGFIRLEKIIETYARNEGSEWAEQANRRWQEDLHLLEQFYEHVDEKPES-YEVEKASL 239 Bacillus halo...
WP_012959683   161 GKILKSSIPDFCFTLSPLITPKSGIVRLQKMVQTYAENEDSTWAREAIERWENDLALLEHFYEEYEDKPES-YELEKQAL 239 Bacillus pseu...
Q5WF28         161 SLTLTPKIPDYCFTLSPMIRVESGMKRLQKMIRTFAEQEPKDWAKSAMERWESDDALLEAFYEQEEDKPES-YVAEKQAL 239 Bacillus clau...
tigr:GBAA_4451 159 KIKLTPKIPDFCFTLSPIIKPQSGLQRIEDALKNIIAEDDHTWAKEARVRWNHDLDLLNRFYEESDELPES-YEIEKQAL 237 Bacillus anth...
jgi:Bcell_1684 160 QKQFQDQIPNYCFTMTPIIKPKSGVERIKNYILEVEEAKEHGWASEALKRLKEDEQLLEGFYID-DEREET-YHQEKSAI 237 Bacillus cell...
Q8EQ20         157 KIPLEKSISDYCFTMSPIIKLQSGFKRIQDTVATYIENQDHDWAKDSFEVWKEEKKTLTHFYED-DLEHKR-YKQELEDL 234 Oceanobacillu...
BAM47286       156 TKQFNNTVPDLCYLITPIIKPTNGYDRIENYLINQLQRQAHEWASDSYRSLTEEIKLLNYFKERNPNMDEDhYEKEKENL 235 Amphibacillus...
ABV62860       240 KTLYEPKISLTIENGGLFYL 259 Bacillus pumilus SAFR-032
Q65HF6         239 QTLYEPKIDIKVQNGGLFYL 258 Bacillus licheniformis DSM 13 = ATCC 14580
P54508         239 KTLYQPKISVEIENGGLFYL 258 Bacillus subtilis subsp. subtilis str. 168
Q9K932         240 RGLYEPRIVIDVVNGGLFYL 259 Bacillus halodurans
WP_012959683   240 AEQYEPKIHVDVINGGIFYL 259 Bacillus pseudofirmus
Q5WF28         240 KELYEPRIKVSLVNGGIFYL 259 Bacillus clausii KSM-K16
tigr:GBAA_4451 238 QEQYEPRITVQIINGGLFYV 257 Bacillus anthracis str. 'Ames Ancestor'
jgi:Bcell_1684 238 KAQYEPSIHISVINGGLFYF 257 Bacillus cellulosilyticus DSM 2522
Q8EQ20         235 KKRYQPTIQITVINGGIFYL 254 Oceanobacillus iheyensis
BAM47286       236 QAIYQPKIKLEVINGGLFYL 255 Amphibacillus xylanus NBRC 15112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap