Conserved Protein Domain Family
DUF2860

?
pfam11059: DUF2860 
Protein of unknown function (DUF2860)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371359
View PSSM: pfam11059
Aligned: 14 rows
Threshold Bit Score: 280.778
Threshold Setting Gi: 122952963
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6LQK6        43 GFSGFINLGAGVTSVESNTlakfgSVdLGNKNIDTL--TNSPDSETSGLPVLGLEIAYTFAs-tRTQIFFGNQLEDYIRF 119 Photobacterium ...
Q7MIV6        44 GFSGTISINIGFGQSQSQN-----NThEDNEITADL--TNQGKKLSQASPFFLGRLQYSFG---DTLVFLGNSEEQIAEA 113 Vibrio vulnific...
WP_011771788  38 GWEFTLGINLGYSAGRSQL-----NTnNDNAVNENL--NNNGQAISKPFIFPTARAQYTFTe-lKTQIFAGDSREKISTA 109 Psychromonas in...
Q9KQJ6        32 GWDVTLSLNSFYVRDKSQM-----NTnDDNAITTDL--QQSGTSTSELLFAPLGNVQYTFAs-gNTQLFAGQSTDQVIEG 103 Vibrio cholerae
Q6LS16        28 GFSGDISLLTGFSNTKSQF-----N--TDIESTPSL--ESSGESDTKALIAPLGAIQYTFAs--DKQIFIGTSRSDLALG 96  Photobacterium ...
WP_009845464  25 GWGGEVGVLVGFGSETDDS---------EAVKKGSL--NSKGESDSSALVVPLGQLRYTFGsdsDQQVFMGTSRGDIIEG 93  Vibrio
Q7MGJ3        32 GFSGEISLLTGYGASQSHF-----NT-ETDATISNY--SSSASREGAALFAPLGNIAYTFGqqlEQQFYLGTAREDIAVG 103 Vibrio vulnific...
Q87KC1        26 GFSGEISINAGVISSESNF-----NT-DNSKTIDSL--NQSAESDTTVIAAPLGSIAYTFGrqlNHQVYAGTTRSDVAVG 97  Vibrio parahaem...
Q74F19        21 GFTGRVDGGVLAVAKADNL-----WG-RGKNHIDSI--HAKPKTVTHLYPIALVDLRYRAEg-sANEFFLSTPPDEVGS- 90  Geobacter sulfu...
Q7P0H5        25 GFSGHLQLGVSHYQLASNF-----LKaPNDGHPIANslTQSPASQSGTAPLIDGEFSYTLAn-tGTQLFISPTNTSTFAA 98  Chromobacterium...
Q6LQK6       120 DFAARAGVRQEIGNAGVIGVSFLQTPLA-TEVWEDPFVTGTNRTNTDRSSNGYRLIWDEIYGTGLELRYSAREVDIDEER 198 Photobacterium ...
Q7MIV6       114 QFQAELGVAHRFNNAMILTAALFGNVPSmEEVWRDPYLTGQKRQTTEQTVGGVRFAMDITSPLPISLKYAIASSEVEYDD 193 Vibrio vulnific...
WP_011771788 110 KFQYELGITHLFNNSSEMTVAYFPQMLSfNDAWQDPYLTGSTRTTTDENAQGGRFALTRIAGSTITLKYAFAFTAIENEH 189 Psychromonas in...
Q9KQJ6       104 QLQAELGITHRFERLGEITLAYFPSLPGiNETWRDPYLTQTARAVTDISAQGGRLAYTAPFALPITLRYAYLDYKVDEEQ 183 Vibrio cholerae
Q6LS16        97 RFHIEAGYRQRFEGNGMVSLSYVPGIIG-TKTWEDPFLVNENRTETDTKIKGFRFQYKNILGSNFSMETSVGQQEIDSEK 175 Photobacterium ...
WP_009845464  94 VFAFEFGYALEYGNESVVSFSYLPTIAN-GEVWEDPFIANTARTKTDISGDTFRVQLDNLLDIGLSGDFAVYKQDIKNDK 172 Vibrio
Q7MGJ3       104 TLAFELGYQYQMSSGVVIDFSLLPTVMS-GETWQDPYLLNQKRTVTDESGIAYRLQFHNLWGGNVNLDTAYGTKELEKDT 182 Vibrio vulnific...
Q87KC1        98 TLAFQLGYQYELPSGTVLDVSYLPTVLK-GETWRNPYQVGTARQTTDEGGNAYRFQIKGLVDRNFTLDLAYADKDVEQDE 176 Vibrio parahaem...
Q74F19        91 ---VALGLKRTLGFGTATGALFYQFA---GRVWENPYVTD--REDTDNRIYGVRLGIEDMGPARLGITYRATLNDVDRDL 162 Geobacter sulfu...
Q7P0H5        99 GGGLQLGVRQQLPQAGTFAAALTYGE---SEVWLDPYALNRVRQDGKLKNVGLMLGWSEILETPFRVSINYSRQKLDNEQ 175 Chromobacterium...
Q6LQK6       199 SGedlGLSAADRAMLDRNGDRNRFSVQYTFNId-ENKHIITPAIAYIDQDLDGDAVAYDGLSFNINYIYSVNRWKFVTNA 277 Photobacterium ...
Q7MIV6       194 IGlsqGLTTEARSQLKRASDYQRFGAEISFPL--SQSFVLSPAFYYTLRDADGDAKSNQLLTAQMSFLIAQGRHSVITTL 271 Vibrio vulnific...
WP_011771788 190 SGqslGLNAKQLTMLQRDSLYQRAEIETMYSI--APGIFFKPALQYTTRSADGEAHNFDQYGLQLSLLVFKGRHSLITTL 267 Psychromonas in...
Q9KQJ6       184 SGatsGLNNTQRALLNRNSEYQQVSAEISLAL--SRSWSLVPQITYTQRDAQGDAFDFTALDYQLGVNTFFGPQALFLTL 261 Vibrio cholerae
Q6LS16       176 SGqkqNLSETEIASLDREGNIIYLEGAYRQPI--APGRLLRGALNYTRFDADGDAMSYDTYGAQLSIIQMLPSSSLALTF 253 Photobacterium ...
WP_009845464 173 SG---VHLGVPTGVLQRDAKGYYASLSMEMPV--SESSFIEPSLSYQKHLADGKAVSFSDYSGSLTYIMMVDDHAFSVNA 247 Vibrio
Q7MGJ3       183 IT---------DPSLKRDGESYYAKLDYRYRL--KPTSFVQPAVVYLKHQADGKAASYDSLGAEVSWFNLFAKHRLVLTA 251 Vibrio vulnific...
Q87KC1       177 VT---------DRSLARDANIYYVKGEYRISL--DQTSLLQPAFTYINQDADGKAESYDSYAFDVSWFKFINRHRLALTA 245 Vibrio parahaem...
Q74F19       163 IG-------DLSPDLERDGSTHRLTLSGKIEA--SREITVTPSVSYERGAADGESNRYHSGEARLSVGWRKGDLSLSGRV 233 Geobacter sulfu...
Q7P0H5       176 SGqaqGASLANQALLKRNGNNYGAQLGYAWKLdgAGEHTLTPGLIYARSDLDGKAMSTKRYGMQLAYAYKGVDWEGNASL 255 Chromobacterium...
Q6LQK6       278 TYATLEYDEANPVYSKK-ADSNRYGASFTAFYNKPFGWDGWLANAGVVWFEEDSDITFYDSSVNLASIGMLYL 349 Photobacterium profundum
Q7MIV6       272 RNSSASFDADNPVFSRK-QDYESFGLFSVYSYADLWGWRNTQLNVMAGYQESDSDIDFYDSEEVFLSTGISYS 343 Vibrio vulnificus YJ016
WP_011771788 268 NTGIKKFAVENPAFNEK-QNTVNAGLFSVYSYDQALNWQPLSFNLLAGYTKEDSDINFYDSEGFFTSTGITYQ 339 Psychromonas ingrahamii
Q9KQJ6       262 SYGQEEYDTAHPIFAKT-RDADRWSAFALYVYRAPFGWQNVSINAMAGLSETDDAVNFFDQQSTFLSTGVAFN 333 Vibrio cholerae
Q6LS16       254 GYKNAQYEAENPVFDEK-QKDDLWSVFLAYEYNEPFGWTDWGLVSLIGYNTTDSNINFYNEDTLMATVGINYK 325 Photobacterium profundum
WP_009845464 248 DYSHRSYDASNPVFKKT-REDNGYSATLGYEYMDVMGWEDWGFNALAGYSSNNSNIAFYDTSGYLMSVGVSYH 319 Vibrio
Q7MGJ3       252 GYKVQDYQAASQLFDKK-REDQQLSLFLAYEYAQLFSSPDWSFVALAGYNQTDSNIEFYKQSDYLLSVGVNYK 323 Vibrio vulnificus YJ016
Q87KC1       246 GYALKDYQSASQTFAKT-RSDDTLSLFAAYEYQNVFDWQNWSFISFAGYSQTDSNITFYDENEYLLSLGFNYS 317 Vibrio parahaemolyticus
Q74F19       234 SGSYAGYDAVHPIYDQT-RTEWGYGAGATASASNVAGLRNVSATLGVIWEQTLANIDFFGTRSTLAFGTIGYS 305 Geobacter sulfurreducens
Q7P0H5       256 AAASTRYQAGNPLFASQkADSREALLSLGLTRKNLFGAKAWSAFLSGNYGRSSSDLAYFDAHVREISVGLGYR 328 Chromobacterium violaceum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap