Conserved Protein Domain Family
Gsf2

?
pfam11055: Gsf2 
Glucose signalling factor 2
Gsf2 is localized to the ER and functions to promote the secretion of certain hexose transporters.
Statistics
?
PSSM-Id: 402576
View PSSM: pfam11055
Aligned: 21 rows
Threshold Bit Score: 508.346
Threshold Setting Gi: 754402955
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003669694   1 MEVYLRLNDDTEKDYAFQISRDEKINTKLSQIFSTDKnn--ekALANTMVLRPSIFHNYKPDYFNKSTHPGYLTEGGCLI 78  Naumovozyma dai...
XP_011271987  15 FEIYVRMNDDSEKDYCFNVTINDSFDK-LLKIFDSLK-----------ISLRPSIFYNQRPIGFKISKSPGYLTDNGGLL 82  Wickerhamomyces...
EAZ63729      16 FDIYVRFNEDMEKDYCFQIKTTTTFRD-LFKIFNTLP-----------IALRPSIFYEAKPVGFEVSTSPGYLTEDGNFI 83  Scheffersomyces...
EGW34633      18 vDIYLRFNDDMEKDYCFQVKTTTTFKD-LYKIFDTLP-----------IALRPSVFYHARPIGFKKSISPGYVTEDGNFL 85  Spathaspora pas...
EMG45996      13 LDIYIRFNSDVEKDYCFQINTNTTFKD-LYKIFDTIP-----------LSLRPSVFYHAKPIGFKKSISPGYLTQDGNFV 80  Candida maltosa...
EER31513      14 LDIYIRFNNDMEKDYCFQVKTTTVFKD-LYKIFKTLP-----------LSLRPSVFYHAEPIGFRKSTSPGYLTEDGNIV 81  Candida tropica...
XP_001486429  19 IEAYIRFNDDEEKDYCFQIKVSSVFSD-LNKIFNSLP-----------ISLRPSIFFNSRPVGYKVLTSPGYLTEDGALL 86  Meyerozyma guil...
Q6BYS2        19 LESYIRFNDDLEKDYCFQIKVDKRYRD-LLEIFKSLP-----------IALRPNVFHYSKPIGFQVSTCPGYLTEDGSLL 86  Debaryomyces ha...
CCK71093       1 MEVYVRLNNDIDRDYAFQVSREDTARSKVSKLFAERPepglkiVLADVMVLRPTLFHKKQPVGYSKSMHPGYLTEGGCLI 80  Kazachstania na...
XP_003957329   1 MEIYLRFNDDFENDYAFQISNEDTINSKIKKIFSTTPnksgmkNLSDIMVLRPSIFHEWQPYEYYKSCHPGYLTEGGCLL 80  Kazachstania af...
XP_003669694  79 FDYDADLPQYISKIDEEKPLFDQLWPGQLILPKWSYNKKYITIYSMIMLFWLYTDLPDVISPTPGICVTNLLSRILIPIL 158 Naumovozyma dai...
XP_011271987  83 FDNNAD--KLTQNVKLSDKISDYCWPGQLVLPIWEENYFLSYSIISLLLVWLYTDLPDFISPTPGICLTNQLSRFFANLA 160 Wickerhamomyces...
EAZ63729      84 FEYD-AHKQTKKIANLDDKVSQHVWPGQLILPVWVFNDFGFYSTIAALATWLYTDLPDFISPTPGICLTNTLSQLAAKVA 162 Scheffersomyces...
EGW34633      86 FDYE-SQKQTERITDLNASINEHVWPGQLIIPEWEFNDFGFYAFLSFLLSWLYTDLPDFISPTPGICLTNQVTRLFAVLA 164 Spathaspora pas...
EMG45996      81 FDDD-AESKTVRVKD-SDLVNDHVWPGQLILPVWEFNDFGFYSFLAFLVCWLYTDLPDFISPTPGLCLTNQMTKFLCWVA 158 Candida maltosa...
EER31513      82 FDDD-SQDQYAPVSD-NDLINEKVWPGQLILPVWQFNEFGFYSFITFLLVWLYTDLPDFISPTPGLCLTNQMTKLLCWAA 159 Candida tropica...
XP_001486429  87 FSYEVSKKEFQKSVSLNDKISDKVWPGQLILPVWEFNYFGFYSFVLFLLTWLYTDLPDFISPTPGICLTNQISRVVGNLL 166 Meyerozyma guil...
Q6BYS2        87 FSYETGMEKFLKKVSFDDKIADTIWPGQLILPVWEFNSFAFYSFITLLVCWLYTDLPDFISPTPGICLTNHMTRGASYLA 166 Debaryomyces ha...
CCK71093      81 FDYDAGEAKYLEKLDEDKPLFDQLWPGQLIVPEWEYSRKNIIMFAAILLFWLYTDLPDCISPTPGICLTNQLSRLLLPVL 160 Kazachstania na...
XP_003957329  81 YSYDAAEPQYLEKLDEEKPLFDQLWPGQLIIPKWKYSGKYVKIFAVIMLAWLYTDLPDVISPTPGICLTNNISRLVIPLL 160 Kazachstania af...
XP_003669694 159 EKgFDSIDLANKLREEIQPNYSSFWAQWCFFIFHILKIGLITLFLQLGIANPITFNPITIIKLTTaasPQEfiKNDDLKH 238 Naumovozyma dai...
XP_011271987 161 QH-FNYDKLAQDLFAEIQPHQSTKLIQIFFFIIHIVKIAFLYFALSLGIFNPYTINPIKMRKIVA---HDK--LDEAKKL 234 Wickerhamomyces...
EAZ63729     163 IH-FGYPNVANTLVEDIG-KSIAIPGQLIFFVFHLLKIAAIFGLLYSGM-----FNPVKLLRFAR---KNI--RDEITKE 230 Scheffersomyces...
EGW34633     165 VY-FKQDKIAALLLEDSA--EVGITGQIIFFVFHIMKILMIFGLLYTGA-----FNPIKVFKLPG---TSIpsPKDLTKE 233 Spathaspora pas...
EMG45996     159 RL-FGQDRMADIIIKDLY-DPVSVGAQIAFFVFHIIKVLFLFGFLYTGL-----FNPIKVFRLPS---RST--GLDVTKD 226 Candida maltosa...
EER31513     160 VQ-FGKQELADIIIKDLY-DPVSVGAQIAFFVFHVVKIFFIFGIFYTGI-----FNPIKVFRWKP---KSV--KLDVTRE 227 Candida tropica...
XP_001486429 167 IR-FDQHKIAELFLADLE-TEVGITAQILFFIVHVVKCLGILTALYIGM-----FNPIRVFKFGD---TP---PKDVSKE 233 Meyerozyma guil...
Q6BYS2       167 TY-FGQHKLAHALIVDIE-DPVGIIGQCLFFVFHLIKVLVIFLLFHLGT-----FNPIRMNRFSG---TKV--PTDISRE 234 Debaryomyces ha...
CCK71093     161 ENyLDNQKMASKLREEIQVGYSSVPAQWGFFTLHVLKLLLIVLFFKFGMANPLTFNPVKMWQLRN---NDLsrKSNDVKA 237 Kazachstania na...
XP_003957329 161 DNyLDQPELADKLREEIAPNFSSVLAQWAFFFLHILKITMLTFLFKIGVANPLTFNALKIYKLRN---FEIshRNAGIKD 237 Kazachstania af...
XP_003669694 239 LLRSIGWIGSKKGGYDSYQSNFYSYIINKFGGPVQAYRAGMIKTAAKPGIPLNNGEGFQTPLNERFTADTFKTMEETG-- 316 Naumovozyma dai...
XP_011271987 235 ELIALGWTGTRRSTLDEYREFYKDFKIKQVGGIVKASKLGLFEKLREPGVFLDDGEGFQSDLNNTTSLKDLELDSS---- 310 Wickerhamomyces...
EAZ63729     231 ELIELGWTGTRKATPDEYNEYFREYKIKEHGGMIQAHRAGLFDIMKNLGCHLGPGEGYNTPIEHKGTFKELLDQASDEen 310 Scheffersomyces...
EGW34633     234 QLLELGWTGTRKATIDEYKDYYRDYKIAEHGGMIQAHRAGLFDTMKHLGCELEEGEGYNTPLTRENMTRTLEQLLQEAkq 313 Spathaspora pas...
EMG45996     227 ELIKIGWTGIRKATIDEYKEYYRDCKIKQYGGMIQAHRAGLFETLKDLGVQLEEGEGFNTPMTEENKLRPMKEIIEAAkk 306 Candida maltosa...
EER31513     228 ELIKLGWTGTRKATIDEYKEYYREFKINQYGGMIQAHRAGLFETLKHLGVQLESGEGYNTPMTEENKMRKMSEIVKESke 307 Candida tropica...
XP_001486429 234 QLIDMGWTGARRATPEEYKDFYREYKIKQHGGMIPAHEAGLFKKLEHLGVFLGRGEGFDTPLDDKSTLKDLLDEDNQ--- 310 Meyerozyma guil...
Q6BYS2       235 QLIELGWTGSRRATPDEYKEYYRDYKIKEHGGMVQAHQAGVFDTLKNLGIYLGEGEGFNTPMDSKSTMADLCDEEND--- 311 Debaryomyces ha...
CCK71093     238 TLKSIGWIGSKRAIFDDYQSNYYNYILKKYGGIVPTFRAGMIKIAANPGIPLQAGEGFQTPLDERFTGSTFKEMEDKG-- 315 Kazachstania na...
XP_003957329 238 VLKSIGWIGSRKASYDQYQASFYNYTIKKHGGIVQAYRAGVIKSAAAPGMPLHAGEGFQTPLNERFTGKTFETIESENp- 316 Kazachstania af...
XP_003669694 317 ---KFILSEEYFIELENNLKENLDLCEGDVGKMNEEIRRFRRFGLYEPNEKIKKMVAKRKQVYLNDQK 381 Naumovozyma dairenensis CBS...
XP_011271987 311 ---KFILNFDWFAIIGENYEYYLDNESKD---KGQDVRNYRRYGPLISNERIEKIVQGRKDKGKELKk 372 Wickerhamomyces ciferrii
EAZ63729     311 ptfKLELNFEYFGQLGLLFTQYVDDKEGS--ELTDYIKQYRRYGLLYSNDNIKKIVEKRKHASVANKl 376 Scheffersomyces stipitis CB...
EGW34633     314 pnfKLRLTYDYFAELGIVFAQNVESKSSS--ELPEFIKQYRRYGLLLSNENLQTIVKARKGIVEKIEV 379 Spathaspora passalidarum NR...
EMG45996     307 pnfKLKVSYEYFAELGYVFGMLVDNKSGS--ELSALIKEHRRYGLLVASERIEKVVKGRKGKLDDEDE 372 Candida maltosa Xu316
EER31513     308 pdfKVRLSYEYFAELGYVFAMNAEDKEGS--ELTELIKQYRRYGLLVSDARIKSVVKGRKGEIEEKPA 373 Candida tropicalis MYA-3404
XP_001486429 311 ---KFTLNYQYLAKLGQFFESYTAENDSN---MVEAIKQFRRYGILHSDEVISKIVSIRKGRGDSRie 372 Meyerozyma guilliermondii A...
Q6BYS2       312 ---KFTLSYDYLAQLGAFFASYIEKEGVD---LADTIKQFRRFGLLHCTDSVKKAVQQRKIFGDSKin 373 Debaryomyces hansenii
CCK71093     316 ---KFILSEEYFIELENILKEKLDEANGDIGLMNEEIKKFRRYGLYEPSDKIRNMVKKRRAVYEEQQA 380 Kazachstania naganishii CBS...
XP_003957329 317 ---KFILSEEYYVEVENNLKSILEKCNNDIGLMNEEIKRFRRFGIFEPNEKMQHLVKLRKEVYTQEKE 381 Kazachstania africana CBS 2517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap