Conserved Protein Domain Family
Musclin

?
pfam11037: Musclin 
Insulin-resistance promoting peptide in skeletal muscle
Musclin is a muscle derived secretory peptide which induces insulin resistance in vitro. It encodes a 130 amino acid sequence including a NH(2) terminal 30 amino acid signal sequence. Musclin expression level is tightly regulated by nutritional changes.
Statistics
?
PSSM-Id: 371352
View PSSM: pfam11037
Aligned: 10 rows
Threshold Bit Score: 186.505
Threshold Setting Gi: 556966203
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006637936   2 LGCRCILLPCLFAVTLLHWSKGILQLAEGAPEFLDS--SLVEAADsrslSSDEKSSNDLAAKLLLLDELVNLENDVIETK 79  spotted gar
XP_005992527   2 LECKLIFLHCLLAVTLLQWSGEKFLLAEGAPESFDS--SMLSEID----SSEEKSSSDLTAKLLLLDELVSLENDVIETK 75  coelacanth
ABQ40394       2 LQFQLVVVHLALVITLLQWHSSSVLLAEAAPEPLEP--SAALGMAahptASEEKSASSLAAKLLLLDELVSLENEVTETK 79  chicken
XP_019695536   2 LDGRLANAHFILAVTLMLWSSGKVRSMDVATEAFD---SGVIDVQspptVREEKSATNLAAKLLLLDELVSLENDVIETK 78  domestic cat
ABQ53647       2 MDWRLASVHFILAVTLMLWSSGKVLSMDVTTKAFD---SELIDVEppptMTEEKSATDLAAKLLLLDELVSLENDVIETK 78  pig
XP_004834833   2 LDWGPAGAHFILAL-LVLWSSGKVLSVDATTEAFD---SVITDVQspptARREKSATDLAAKLLLLDELVSLENDVIETK 77  naked mole-rat
P61364         2 LDWRLASTHFILAMIVMLWGSGKAFSVDLASQEFG-----TASLQspptAREEKSATELSAKLLRLDDLVSLENDVFETK 76  house mouse
XP_012402138   2 LDWRFVATHLILAIFLMQWSTGKGPGVEAAPEQAIN--SIAENAQshieNTEEKSATELTQKLLFLDELVSLENDVIETK 79  Tasmanian devil
XP_017949518  45 LEWHCVSVSLLLAVSFVQWTSTEAAPAEPSTESLDT--AVVLDGSshsvSSEEKSAADLAAKILLLDELVSLENDVIETK 122 tropical clawed...
XP_001512349   2 LESRLVIVHFIFAVILMPWSAGTALLVDAEPE---SfdSVAEAMQshsaSSEEKSSTDLETKLLLLDELVSLENDVIETK 78  platypus
XP_006637936  80 KKRSFPGFGSPLDRLSVNNMELKGKQRKVVDLPRRRLNVPIDRIAMNRIPNSRG 133 spotted gar
XP_005992527  76 RKRSFPGFGSPVDRLSVSSMDLKNKPRKVVEPPKRRFGVPIDRIGTNRLANSRG 129 coelacanth
ABQ40394      80 KKRSFPGFGSPIDRISATSVDAKGKQRKVVELPKRRFGVPLDRIGVSRLGNTKG 133 chicken
XP_019695536  79 KKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPVDRIGGNRLSNSRG 132 domestic cat
ABQ53647      79 KKRSFSGFGSPLDRLSAGSPDHKGKQRKVVDHPKKRFGIPVDRIGRNRLPNSRG 132 pig
XP_004834833  78 KKRSFPGFGSPIDRLSAGSVDHKSKQRKAAHHSKRRFGIPVDRIGRNRLSNSRG 131 naked mole-rat
P61364        77 KKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG 130 house mouse
XP_012402138  80 KKRSFPVFGAPLDRLSAGSFNVKGKQRKTVDLPKRRFGVPIDRIGSNRLANTRG 133 Tasmanian devil
XP_017949518 123 KKRSFPGFGSPLDRLSAGTTEFKGKQRKVVELPKRRFGIPLDRIGMNRLANTRG 176 tropical clawed frog
XP_001512349  79 KKRSFPGFGSPLDRLSAGSVDVKGKQRKVVELPKRRFGVPVDRIGANRLANTRG 132 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap