Conserved Protein Domain Family
YqgB

?
pfam11036: YqgB 
Virulence promoting factor
YqgB encodes adaptive factors that acts in synergy with vqfZ, enabling the bacteria to cope with the physical environment in vivo, facilitating colonisation of the host.
Statistics
?
PSSM-Id: 151483
View PSSM: pfam11036
Aligned: 2 rows
Threshold Bit Score: 80.4732
Threshold Setting Gi: 81416240
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7CPU0  1 MKKKPVAQAEHQRYLLENPLVYGLLSRLRIAIVVNCFTLANKN 43  Salmonella enterica subsp. enterica serovar Typhimurium
P64567  1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII 43  Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap