Conserved Protein Domain Family
DUF2848

?
pfam11010: DUF2848 
Protein of unknown function (DUF2848)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402552
View PSSM: pfam11010
Aligned: 21 rows
Threshold Bit Score: 251.853
Threshold Setting Gi: 81375198
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABS05672        39 AGYAGRDQAEVARHIAELAELGVPAPATTPALYPVSPYLAAQADVVPVQHERTSGEAEWALVVSgpdPEDVLLTVACDHT 118 Kineococcus r...
tigr:AAur_0619  30 AGYTGRDPKAVQHHIDELAAIGVAPPPEVPMFYRMDSDLFETSGEHDTSENLTSGEIEPLYIRH---NGQYYLGIGSDHT 106 Paenarthrobac...
Q5YY09          30 AGYTGRDEAAVRHHIDELAAIGVAPPESVPMLYPVSTATVTTAATTPVPSADTSGEVEPVLLRH---RGRYFLGVGSDHT 106 Nocardia farc...
Q0S9Y2          30 AGYTGRDEAAVQHHIDELAAIGVAPPAQVPMFYPVEIATITTASQAPVTGAHTSGEVEPVILRH---RGRYYLGVGSDHT 106 Rhodococcus j...
jgi:Arth_3539   24 AGYAGRQQEEVQAHIAELAELGVPGPATTPALYPVSPYLAQQVSEVRVQHDRTSGEAEWALVIT---EDGVLLTVACDHT 100 Arthrobacter ...
OQJ53493        24 AGYAGRDQAEVQAHIDELAELGVPGPETTPALYPVAPYLASQADTVPAQHGRTSGEAEWALVVT---DDDVLLTVACDHT 100 Clavibacter m...
BGI:SBI_08427   24 AGYAGRSQDDVAAHIAELAELGVPTPSVTPTLYPVAPYLAQQTDRVAVQHRHTSGEAEWALVVAg--DGELLLTAACDHT 101 Streptomyces ...
CAM04976        23 AGYAGRGQDDVAAHVAELAELGVPAPTRTPCLYPVAPYLAMQVDEVPVQHGRTSGEAEWALVVAgpdERDVLLTVACDHT 102 Saccharopolys...
Q0SCB5          24 AGYAGRNQEEVASHIAELAELGVPAPTNIPAMYPISPYLAQQTTEVFVQHGRTSGEAEWAMVIT---DDDVLLTVACDHT 100 Rhodococcus j...
Q89R11          27 AGWTGRDPVARDKHIAELQEMGIAPPASTPIYYRASARRLTMEDRIECCGGDSSGEVEFVLIGW---QGRIFVGCGSDHT 103 Bradyrhizobiu...
ABS05672       119 DRALEVHGVAWSKNASLDVLGRRAWRLVDVED-HLDQLRLRAWvHAGDG-PGTLVQDAPLAALLPPSYWLDALR-ARGLA 195 Kineococcus r...
tigr:AAur_0619 107 DRDIEARDIGDSKRACPKPVAGEVIAVESLEDlDLDTCTARSW-----V-DGTLYQEGSLSGLRKPADVVERLL-ARTDI 179 Paenarthrobac...
Q5YY09         107 DRALETIDIGESKRACAKPIGPHVVEVADWSRfDWDACRARSW-----V-DGKLYQDGTLAALRTPTDLLGVVA-DR--L 177 Nocardia farc...
Q0S9Y2         107 DRQLETVDIGDSKRACPKPVGPAVVEIADWSSfDWDACRARSW-----V-DGVLYQDGTLANLRTPQTLLQIFA-DR--I 177 Rhodococcus j...
jgi:Arth_3539  101 DRQLEVHGVAWSKNASPDVLGRKAWRLDDVRE-HLDQITLRGWvGEGDT-PDTLIQDSSLGALLSPDYWLDVLA-ERGLN 177 Arthrobacter ...
OQJ53493       101 DRALEVHGVAWSKNAGPDVLGRKAWRLADVRD-RLDAIRLRGW-VGEEG-AEELIQDSTLAALLTPDHWLEVLA-ERGLR 176 Clavibacter m...
BGI:SBI_08427  102 DRDLEVHGVAWSKNAGPDVLARRAWRLADVEP-RLDDLTLRAW-VTRDG-TETEIQHGTLAELLTPAYWVDVLR-SRDAL 177 Streptomyces ...
CAM04976       103 DRELEVHGVAWSKQAGPDVLGRRAWRLADVAD-RVDELTLTAW-----A-GGERIQRGTLGELLTPQYWLGELR-ERGLL 174 Saccharopolys...
Q0SCB5         101 DRDLEVHSVAWSKNAAPDVLGTRAWRLSEIAD-RLDDITLTAWvGQGDGePSTLIQTGTLADLLAPKYWLDVLG-EQGLY 178 Rhodococcus j...
Q89R11         104 DRKVEAYNVTVSKQMCDKPIASTLWELEDVIG-HWDKMILRSY-ATIKG-ERVLYQEGTLDAMLPVADLIAR-GfDGTRF 179 Bradyrhizobiu...
ABS05672       196 TP---GTVLLSGTVAMVpGVDQFARRWSVRLEDPVRGDALELGY 236 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
tigr:AAur_0619 180 GDa--DFMCLGGTLPLLnGKFVDGTSWKLELSFP-NGTTIEHNY 220 Paenarthrobacter aurescens TC1
Q5YY09         178 GDdggDFVCFAGTLPLLdGEFTPGTRWDLELLLP-DGRALTHTY 220 Nocardia farcinica
Q0S9Y2         178 GDtgeDLLCFAGTLPLLdGKFTPGHRWDLELTLP-DGRTLTHSY 220 Rhodococcus jostii RHA1
jgi:Arth_3539  178 EP---GTVLISGTVAMThGVDQFARSWKVEMADPVTGASVEAQY 218 Arthrobacter sp. FB24
OQJ53493       177 VP---GTVLISGTVAMIpGVDQFASRWRVQLEDPATGETIDAAY 217 Clavibacter michiganensis subsp. sepedonicus
BGI:SBI_08427  178 NP---GTVLISGTIPMTpGVDQFADAWRVELGDPATGDTIRLAY 218 Streptomyces bingchenggensis BCW-1
CAM04976       175 AE---GTVLLSGTIPMDvGVDQFAGSWRVELGDPATGDTLACEY 215 Saccharopolyspora erythraea NRRL 2338
Q0SCB5         179 KP---GTVLVSGTISMRhGVNQFADAWKVALRDPATADELTCSY 219 Rhodococcus jostii RHA1
Q89R11         180 PD---GCAMFGGTFAAK-GGIRPADRFDFELEDPVLKRTIRHGY 219 Bradyrhizobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap