Conserved Protein Domain Family
DUF2840

?
pfam11000: DUF2840 
Protein of unknown function (DUF2840)
This bacterial family of proteins have no known function.
Statistics
?
PSSM-Id: 402542
View PSSM: pfam11000
Aligned: 47 rows
Threshold Bit Score: 168.155
Threshold Setting Gi: 503064800
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q89YA6         23 THVELTWIEKRIEHWLRFGRRAEEKILDRRRSISSFEPGSIFGFVRWASNDYGTVVSRMDIVRAVEAGQRYQTLPFVRPG 102 Bradyrhizobium...
Q2GBG2         30 TEVELYWQEGVREHWLRFGKPVASRICDRRRRVECYAPGQVFGLVRWASNDYGTVLSRLDVLLAVTEGEPVTRFPQVTPG 109 Novosphingobiu...
EFG84820        3 THLELTWLEKRIEQWLRFGHALETHPIDRYRRRLSFAPGAVFALLRWTQADCRTTTCCIDIIRAPLAGEPCDRLPFVPTG 82  Komagataeibact...
CAP44917        4 TRVALASIGRHVRIRLRFGAPQRIVRLDAYRRLAIFMPGAVCCRVSWAANAYGTVAWTLMVMQAATPLDAVQRISGVVPG 83  Bordetella petrii
jgi:Pnap_4169  33 TRVALAYVDKRINLYLRFGNPARTIQLDRWRRSAVFLPAFIFCRIRWESNDYGTTRWQLMVMQACTPLDAVQRIPGIHPG 112 Polaromonas na...
jgi:Daci_2718  26 TRVALAYIDQRFDLYLRFGDPARIIRFDRWRRCAVFTPNAVLCRIRWQANDYGTIRWQLMVMQACMPMDGAQRISGVQPG 105 Delftia acidov...
Q1LNA6        133 TRVSLAFLEHRFKLYLRFGEPARTQRLDRWRSLAVFMPNAVFCRIRWQANDYGTVRWQLMVMQACTPLDAAQRIPGVQPG 212 Cupriavidus me...
WP_011805840   37 TRVSLAYIEPRFKLYLRFGEPARTLRLDRWRRCAVFLPRAMFCRVRWEANDYGTIRWQLMVMQAGAPPDDVQRIPGVRPG 116 Comamonadaceae
WP_012522059   19 TWVELVWYEKRIERWIRFGQVREERLLDRRRRLVGFAPGDVFAFVRWQANDRGTVGSRLDIVQAVAPGGRCSTVAGVTPG 98  Phenylobacteri...
jgi:Caul_2249  10 TRVELVFLKDRIERWIRFGRPIAEQVHDRRRRAVMFAPGAVFAFVRWRAGDYGTVDSRIAILKAVAPGTPFTTYPEVSPG 89  Caulobacter sp...
Q89YA6        103 GEILLRVDSWPKVERVLQAIDAIEALSIDPADAAPEYWRHLHNRLAADHVPRAYTREQHIAWLKRRS 169 Bradyrhizobium japonicum
Q2GBG2        110 ADVLLSVTGWRKVRRVFGLIDAIEELGIDPCDVAPDHWRHIHNRLIVAETPRSYSTERHRAWLARKA 176 Novosphingobium aromaticivo...
EFG84820       83 AERLLLFTGWPQVRAVLSVIETVERQGINPVDVDPEYWRQLGRSRPDGRDIPRYSTPRHAAWLRRRI 149 Komagataeibacter hansenii A...
CAP44917       84 ARLLLRVDGKRQVKTVLALIDAVEVGGIAPVTVSPAYWRTVANRLAARQAPPVYTAERHAAYLARRT 150 Bordetella petrii
jgi:Pnap_4169 113 ARILLHAEGERQVQAVLPLIDAIEALGIAPIDVSPAYWRTLGNRLSAHLALPQYTAERHAAWLAGKE 179 Polaromonas naphthalenivora...
jgi:Daci_2718 106 ARLLLHAEGEQSVRAVLARIDAIEALGITPVGVSPAYWRTLANRLAAHLPLPEYTAERHAAWLAGRA 172 Delftia acidovorans SPH-1
Q1LNA6        213 ARLLLHVEGENQVRAVLERIDAIEALGIAPSAASPAYWRTLANRLAARLPLPEYTAERHAAWLIGKE 279 Cupriavidus metallidurans CH34
WP_011805840  117 ARLLLHAEGENAVRAVLERIDGIDAQGIAAIDVSPAYWRTLANRLAARLALPEYTAERHTAWLAGRT 183 Comamonadaceae
WP_012522059   99 GELLLRLSGWPTVQKALAAIDAVELVGVEPTAAAPDYWRQVHNRLKARASPEPYTLVRHRAWRLRSA 165 Phenylobacterium zucineum
jgi:Caul_2249  90 AEILLDLAGWTRVQAVLEAIDGVERVGVRPELAAPDYWRHVGARIGAGLPPREYSRRRHRAWLLRRM 156 Caulobacter sp. K31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap