Conserved Protein Domain Family
DUF2816

?
pfam10992: DUF2816 
Protein of unknown function (DUF2816)
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 402535
View PSSM: pfam10992
Aligned: 15 rows
Threshold Bit Score: 92.4582
Threshold Setting Gi: 229596058
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGR34317      69 QPVLGQSRLEHIPYQRKVVDYEQQVSTTIVPKERLVQDYYTIEHQVSYIPNVIQEPYVDYVPVQRYKQRVEYNAVesSRA 148 Ichthyophthiriu...
Q3SDZ3        80 PTIKGESRVEYREYQRPVVEMETETVQVQVPKTKYVTDYYPVEYQTEYIPRTVYEQQTEYVPVTKTVPRVEYEAV--ERE 157 Paramecium tetr...
A0CIY3        51 ATIKGESRYEYVPYQKSVVEIEEEQRVVKVPKQKWVTDYYPVEYQKEYIPQVTYEKQVDYIPVEKTVPRVDYL----ERE 126 Paramecium tetr...
Q3SDG1        57 SPIRGESRVEYVPYQKPVVELEEEVRTFQVPKQKWVTDYYPVEYQKEYVPQVSYEKQIDYVPVEKNVPRVDYLEY--ERE 134 Paramecium tetr...
EGR33016     144 EAIKGESRIEYVPYEKSMIEYEAIQRTEYIPKEKRITDYYAVEYQTEYIPQVYQDRYIEYIPQERVQERVEYQAI--EKQ 221 Ichthyophthiriu...
XP_004023983  10 QTIKGESRVEYVPYEKSVLEYQAIQRTKLVPKQKRVTDYYAIEYQTDYIPNVYQDKFIEYIPQERFQERVQYQAV--EKK 87  Ichthyophthiriu...
A0DJ03        81 QAVKGESRIEYIPYEKTIMEYEEVRRQIQVPITRQITEYQAIQYETEYIPQVIQEKVIEYMPVEKFAERVEYQTV--TRQ 158 Paramecium tetr...
Q3SDH1       103 NVVKGQSRIEYIPYERTITEYEEVRRQVQVPITKQVTDYYAVQYDIEYIPQVIQEKQIEYVPVERVAERTEYYTV--EKQ 180 Paramecium tetr...
Q3SDE1       106 QAIKGESRIEYVPFERVITEYEEVRRQVQVPVTRQITDYYAVQYEVEYIPQVIQEKQIEYVPVERIQERTEYYTV--QKQ 183 Paramecium tetr...
Q3SDE3        89 NAIKGESRIEYIPYTKEVTEYVTQEVVEYVPRERKITDYYAVEYVTEHIPQVIQEKYIEYVPVETIKERTEYQAV--TKQ 166 Paramecium tetr...
EGR34317     149 ITQPN 153 Ichthyophthirius multifiliis
Q3SDZ3       158 VQRPQ 162 Paramecium tetraurelia
A0CIY3       127 VRRSS 131 Paramecium tetraurelia
Q3SDG1       135 VRRAP 139 Paramecium tetraurelia
EGR33016     222 IVHQP 226 Ichthyophthirius multifiliis
XP_004023983  88 IMHQP 92  Ichthyophthirius multifiliis
A0DJ03       159 NVLQN 163 Paramecium tetraurelia
Q3SDH1       181 NVIQQ 185 Paramecium tetraurelia
Q3SDE1       184 NILPA 188 Paramecium tetraurelia
Q3SDE3       167 SVVQA 171 Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap