Conserved Protein Domain Family
DUF2806

?
pfam10987: DUF2806 
Protein of unknown function (DUF2806)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371326
View PSSM: pfam10987
Aligned: 26 rows
Threshold Bit Score: 181.34
Threshold Setting Gi: 81386671
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q15NK3            69 TRvqrRQKIAAQRKLSNIESVLEKALKYCI--EEGENERLDPDWFYNFANMAEEIHSPAMQELWGKIFAVETNRPGSFSL 146 Pseudoalter...
chanu:ambt_00760  76 ER---RKQIIELQKAANLQAVLNIALNVNI--TESENDGLDPDWFFAFSNMAEEIHSPGMQELWGKIFAVEVSKPGSFSL 150 Alteromonas...
Q087A2            46 ERaeyRQRKQLSQYQTNLESIFALAINYTP--SDVTGVELDPDWRYQFFQMAEQIHNRKMQDLWARILASEIVNPGNFSL 123 Shewanella ...
Q3IG85            60 ARaqkRQDLLLIKQQQNIETILAMAMDFCP--DVASSKQPDADWVEHFVALCGDTSNQSMQSLWAKILTGETLNPGTFSI 137 Pseudoalter...
Q489W1           103 DRtvkRARLSQLRKQQNIENIMQKTLGYCA--SFEIGQRTDHDWFSRYIALSEEVSNPTMQDLWAKILAGELTKPGAFSF 180 Colwellia p...
WP_013307081      68 lRiqeRILFKELERQNNIDQIAEIAAKQLQqeSNVSEEPVSKDWSKRFFNIAEDVSDEEMQEIWGRILAGEIKNPNSYSL 147 Maribacter ...
CCK81254          93 DRcsnRIDYQERKKQENIEKITATAANELAheTDVPNEPPEEDWITRFFNCAQDISSDEMQELWGRILSGEIKKPGSYSL 172 Desulfobacu...
WP_012068665      60 FRaakRVSTQETRRQENIEEIMDKSLNYLErqFSNEATYIDTDWLSFYFDKCQDISIDNVQNLWAKILAGEVLEPEACSR 139 Marinomonas...
Q9KMB5            63 QRgieRFVQQEARKQANIEAITAQAASQLD--ESAKTDNLEEDWIAHFFDKCDKVSDAEMQTLWSSLLAGEAQNPGTYSK 140 Vibrio chol...
chanu:ambt_08740  63 QRaieRHVKQESKKQENIEKITAQAAVNLP--PNAKPEDIEDDWLTHFFDKCDKISNDQMQSLWSNLLSGEATKPGKYSK 140 Alteromonas...
Q15NK3           147 RTLLILKQLTQKDAQTFRRAVALSSRRKGDTTPKLLTGFYQQPSILAMFRLRKEQQLNLATFGLSYPDLLSLMDLGLIHQ 226 Pseudoalter...
chanu:ambt_00760 151 RSLQMLKLLTHRDAKVFAKAVSIASRRQHDTIPRILVGFHRKKGILSFFKRAVPEQLNLASVGLSYPDLLALQDMKLLYA 230 Alteromonas...
Q087A2           124 RTLAVLLQLTFREALIFEKALGMSVKINTEPRFKLLSSYRINGGMKQYFRKHTQTNFGLSQFGLPYSSILTLVDAGILHK 203 Shewanella ...
Q3IG85           138 KSLQTLKHMTQREADSLQKCVSLSGYNEKDDSHFILLGFYKKPSLFDLLRKGNKVSLNLGKTGISFPDILTLMDLNLLYR 217 Pseudoalter...
Q489W1           181 KALQVFRDMSIYDAKLLAKACSLAIKDPNKKNIRLITGAYQQPGLFNFFSKQRQQYCNLSHYGLNYADLLALSENHLIYL 260 Colwellia p...
WP_013307081     148 RTLELLKNLSKKEADTFIKFANLSVSSNGVS---FMLNFKNEPLLED-------------TYKVNFHERLLLEELGLLTA 211 Maribacter ...
CCK81254         173 RTLEFIKNLTKKEAHTFEQVAKLAIQIPGDT---WVVIVHNKTWLKD-------------NRQIFPMHQFLLGELGVMYP 236 Desulfobacu...
WP_012068665     140 GTLLILQSLSNNDIKLFNKYCQYLFKVNGEL----------------LRFKYSSLNKHLENNGIDESDIRHLQDAGLVQP 203 Marinomonas...
Q9KMB5           141 RTVDFVATMDKKDAELFTNFCQFVWMVGGAT--PLIFDFENE---------------IYTKNGINFASLKHLDAIGLISF 203 Vibrio chol...
chanu:ambt_08740 141 RTVDLVASMDRKDADLFTRFCQFTWMVGEPT--PLIFDVTDE---------------VYSSAGITFSDLKHLDAIGLISF 203 Alteromonas...
Q15NK3           227 TEIESGEWPVNSVVEWRSN--GQVFQLSARKPGT----TLKYYKFTTSGAELFTLVGVNKQANYIEALK 289 Pseudoalteromonas atla...
chanu:ambt_00760 231 SEIESGEYAEGQQTRWRCG--AEQFTLESKQPGV----ALVYFKFTAVGGELYKLVPRKQNPAYLSALK 293 Alteromonas naphthalen...
Q087A2           204 SEFETGLLNSNEHIQLTMC--NATLSLKPKHQHL----LFTYYRFTTVGDELCQLIQAKSDDEFINAVK 266 Shewanella frigidimari...
Q3IG85           218 KEIESAVLKTGQELTLSFL--SQKVTLKAKNSDL----VLSYYKFTQTGDELSKLINYPVNKVYKQLLN 280 Pseudoalteromonas halo...
Q489W1           261 QESESSLLSKDDSLQFTYN--GLPLKLTAKKSNV----CLQFYKFTPLGAELAHLISDKSNDEFFDHLK 323 Colwellia psychrerythr...
WP_013307081     212 NDLQFKVHATKGNTDLQYFviSKTIIAVEKSPNIpe-qQLQILVFTKIGQELLKLVESNSDLEYVKLLA 279 Maribacter sp. HTCC2170
CCK81254         237 SDLSFNAFEDSKTTEIALF--SDAHLLLLKRGEIktkvQIPIWKFTGIGKELLSLTQKPLDEQYFNYIg 303 Desulfobacula toluolic...
WP_012068665     204 Q--QQFHFTKNERYVVEYF--DNQFSMILKGHREnrteFL-----TKAGRELYRFIDTSPCEKYYEILL 263 Marinomonas sp. MWYL1
Q9KMB5           204 ESLSGYRRFGLPKKAVFFY--YGQPTLVEFENDNnnevQIGKVLFTKAGLELINICGAKRSQEFYEYsv 270 Vibrio cholerae
chanu:ambt_08740 204 ESVSGYAKQGVSKKGIVFY--FGQKTLLKFPEDEnnkfGIGQALYTQAGKELVTICNAAKNEKFIDYCK 270 Alteromonas naphthalen...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap