Conserved Protein Domain Family
DUF2794

?
pfam10984: DUF2794 
Protein of unknown function (DUF2794)
This is a bacterial family of proteins with unknown function.
Statistics
?
PSSM-Id: 402528
View PSSM: pfam10984
Aligned: 42 rows
Threshold Bit Score: 108.453
Threshold Setting Gi: 123525784
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
zhongguo:SL003B_0439  35 VSFDRRELDQILRLYGRMVADGEWRDYAIDLLKDKAVFSVFRRTSEMPMYRIEKDPKLARRQGAYSVVAAGGLILKRGHE 114 Polymor...
WP_013695078          16 kFFNKKELGEILNLYGSMVSVGEWKDYAIFINKNIVGFNIYRKATENPLYQIIKNLSAKSRNQKYSIRDQAGSILKNSNQ 95  Candida...
Q4FNX8                20 qFFEKNELKIILDLYAKMVSEGSWKDYGLNISNRQVSFSVFKNAAENALYKICKNFKPSNKNLKYLITDSNGKVLKNSFD 99  Candida...
ADO41638              15 VAFHRTELQPILNVYGRNVAAGEWRDYGIANLRDVAIFSIFRRAAETPVYRIEKRPKLRMRQGQYAVIGAEGQVLRRGND 94  Ketogul...
WP_013477901          18 VFFERRELELILRLYGRKVASGDWRDYGIDSLAEVVAFNIFRRSGEAPVYRIEKRPSLARKQGAFAVFNQNGMVLKRGRE 97  Asticca...
WP_012520705          15 VFFERRELERLLRLYGRMVAAGEWRDYGMDSLPDAAVFSVFRRTAEAPLYRIEKRPALARRQGAWAVVGQGGLILRRGHE 94  Phenylo...
Q9A2A2                14 VFFERRELDQLMRLYGRMVAAGEWRDYGIAGLSESAVFSIFRHAAEAPLYRVEKRPALARKQGAWAVYGQGGQILKRGHE 93  Cauloba...
Q2RPR2                17 VHFSRTEINQLLSLYSRQVTKGLWRDYAIDHDDTVARFHVFRHAGEKPLFTVVKRRDAGASAAAQTFSLYAGTHRMRQGE 96  Rhodosp...
Q2W7N2                17 VHFERGEITQLLTLYATRVACGEWRDYAIDVLPDGAVFSVFRHAQERPLYTVTKS-APGTRGSCWSV-ARSGRVVSRFPT 94  Magneto...
WP_013267950          16 VFFERRELDLILRVYGRMVAQAEWRDYAMVGGRESAEFAVFRRSGDAPAYRIEKRPSLQARQGQWSVIGEGGVVMKRGRE 95  Brevund...
zhongguo:SL003B_0439 115 LASVL 119 Polymorphum gilvum SL003B-26A1
WP_013695078          96 LKSIL 100 Candidatus Pelagibacter sp. IMCC9063
Q4FNX8               100 LEILL 104 Candidatus Pelagibacter ubique HTCC1062
ADO41638              95 LQAVL 99  Ketogulonicigenium vulgare Y25
WP_013477901          98 LEPVL 102 Asticcacaulis excentricus
WP_012520705          95 LEQVL 99  Phenylobacterium zucineum
Q9A2A2                94 LAQVL 98  Caulobacter vibrioides
Q2RPR2                97 GLLDL 101 Rhodospirillum rubrum ATCC 11170
Q2W7N2                95 LSGal 99  Magnetospirillum magneticum AMB-1
WP_013267950          96 LAQVL 100 Brevundimonas subvibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap