Conserved Protein Domain Family
DUF2793

?
pfam10983: DUF2793 
Protein of unknown function (DUF2793)
This is a bacterial family of proteins with unknown function.
Statistics
?
PSSM-Id: 402527
View PSSM: pfam10983
Aligned: 51 rows
Threshold Bit Score: 81.8928
Threshold Setting Gi: 296927241
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Hbal_3222  23 HNEAISLIDCLVQMTVKSADTATQPEYVSEGDMYILPDQITGSkWEHmSPASLAVYTGGAWKEIIPKIGWICAVVDTSSL 102 Hirschia balti...
Q2SAL8         26 mDANLKRLGALVGLSVKGRHTSAPPATAQEGDRYLIPVNATGE-WEN-KAGQVAVRIQNAWDYYTPQTGWLCFVEEEARL 103 Hahella chejue...
jgi:Dshi_2162  23 VNESLLRLDAVSQLVLQSLSETVPPNDAEDGEVYAVPQGAQPP-WQA-LPGKLALRSNGGWVTITPRPGWQAWVVELGAL 100 Dinoroseobacte...
Q28RU8         23 VNEALVRLDGLAQLRLQSVTETTPPAA-LDGFAYGVPTGAVDA-WAG-QEGSIAIASGGGWDFVSAQRGWRAIVLDAGSL 99  Jannaschia sp....
WP_020949356   25 VNDALLRLDGMVDLVLQSLSRTQPPAGVVDGMCWGVPPGAVNA-WEG-RGGQIAIGANGGWVFVTPRLGSRAYIADQGVP 102 Paracoccus ami...
WP_011749160   25 VNEALMRLDGQVDLVLQSLTRITPPETVVDGLCWGVPQGAVNA-WEG-QGGKIAIGANGGWIFVQPGFGRRAVVADQGVV 102 Paracoccus den...
Q0AQM3         24 VNEALMRLDALVQAVVQSRSVTVEPATPAEGAAWIIPGGASGTaWSSlNAGDIAVWRDGYWTAFTPADGWRVSVIDERAG 103 Maricaulis mar...
Q9A5S6         25 INESLSRLDALVQLAVESRALTAQPISPVAGGVWILPTAATGAaWGGlAAGTLMRFEAGAWEALAPAEGMLAWVKDENQV 104 Caulobacter vi...
WP_012287646   25 VNEALGRLDGLVQLAVQSRTVAAQPGSPADGAIHILPPGATGAsWLNqAAGLLARHADGVWETLTPAAGWLAWIIDEGLA 104 Caulobacter sp...
WP_013270051   25 VNEALTRLDGLIQAAVVSRTVAVQPADADDGALYILPPSPGGAvWSTwSAGDLVRAEFGGWTRVPVPSGMIAMVLDEGEL 104 Brevundimonas ...
jgi:Hbal_3222 103 LMF--SSEGWQ 111 Hirschia baltica ATCC 49814
Q2SAL8        104 CAY--TGTDWS 112 Hahella chejuensis KCTC 2396
jgi:Dshi_2162 101 CVF--DGSGWV 109 Dinoroseobacter shibae DFL 12 = DSM 16493
Q28RU8        100 AIF--DGTGWR 108 Jannaschia sp. CCS1
WP_020949356  103 AIH--DGALWV 111 Paracoccus aminophilus
WP_011749160  103 AIH--GGAGWV 111 Paracoccus denitrificans
Q0AQM3        104 LFWdeDNARWr 114 Maricaulis maris MCS10
Q9A5S6        105 VAF--DGAAWT 113 Caulobacter vibrioides
WP_012287646  105 LIH--DGQNWT 113 Caulobacter sp. K31
WP_013270051  105 VVR--DSTGWS 113 Brevundimonas subvibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap