2V1L


Conserved Protein Domain Family
DUF2787

?
pfam10980: DUF2787 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF2787)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402524
View PSSM: pfam10980
Aligned: 20 rows
Threshold Bit Score: 127.401
Threshold Setting Gi: 123574711
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2V1L_A        17 FHALLANILSEHQAKSEV--QATSKEVVMNFRDSSYSAEDGGFHPVEIALSQSSDGQWCIEYITDFAYVG-NHFPELERC 93  Vibrio cholerae O1
Q5E056        24 LNQCLVDALNQRSELHSG--LEETNSVIFNFRDKNYSAENGGFHPVEIALTKEADNTWRYAYITDFAFVG-NRYPELAKE 100 Aliivibrio fisc...
Q7MNB0        17 LHALLGEQLTKQLVNDSSgtLAASRYLVFNFRDKSYSADEGGFHPVEIGICHTTSGDWSIEYITDFAYIG-NYYPELERS 95  Vibrio vulnific...
CAV18842      17 LHALLNNHFQQQLTQCES--IAQSTYLTFNFRDSSYSSEAGGFHPVEIAMTQISSGLWNVEYITDFAYVG-SVYPELARC 93  Vibrio tasmanie...
Q7MNA6        17 CHQLLSEHCQTLLTLNSL--EATSQRLTICFRDKSYSAESGGCHPVEIGLNITNKANVTIIYITDFAYVG-NHYPELKRH 93  Vibrio vulnific...
WP_013785802  16 FAAALAELLLQNQVSGSS--------VTINFRDPNYSAEEGGFHPVEIRLEK-QNGTWHFCYITDFTYVGiGPYAELAKD 86  Alteromonas nap...
Q8EGY7        15 FYELLERQLG-------AlnHPDLNSVTFNYRDPDYSYESGGYHPVEINLYR-QDDCWYLNYFTDFAYCG-GPFPELEKE 85  Shewanella onei...
WP_011865057  15 FYELLEQQVA-------Tv-dSGTNLVTLNYRDPDYSAESGGYHPVEINLYR-SGDQWQLNYFTDFAYCG-GPFPELEKE 84  Shewanella loihica
WP_013050620  17 LYTLINQVLM-------TaePKSSNAITLNFRDPEYSAEAGGFHPVEIRLEK-QDAHWRMVYMTDFAFHG-YPIPELIKD 87  Shewanella viol...
Q8EGY6        17 FYQVIEKELA-------NvdPKDANAITLNFRDPDYSAEAGGFHPVEVRLEK-QQEHWRLVYVTDFAFRG-HPFPELVKD 87  Shewanella onei...
2V1L_A        94 LDFDFQRGDFFTAYHG-WNPIVgNRDARELYQLWESNFLAY-VATEAFDDISLT 145 Vibrio cholerae O1
Q5E056       101 LDFDFLSGEWFASYLGrYSSIKdDGAAKELYQLWEHNFLAY-TDMGMYDEIEIN 153 Aliivibrio fischeri ES114
Q7MNB0        96 LDFDFRVGEFFVAHRG-WLPMKgRLDAKELYQLWESNFLTY-ADMEVYDQVSVT 147 Vibrio vulnificus YJ016
CAV18842      94 LDFDFRDQAFFTEFGG-WSPIKgNYSAVEMFELWQDNFLNY-IDMEAFDSISIT 145 Vibrio tasmaniensis LGP32
Q7MNA6        94 IDFDFSHQLYFTVEAG-WQRIQ-PSGVDDLYRMWEQSFIKH-VQNGEYDEIKAv 144 Vibrio vulnificus YJ016
WP_013785802  87 LDFDFQAG-VFQNLFG-VFPIE---TAWDIYQIWEGNFLHYwQELGVF-TIKTt 134 Alteromonas naphthalenivorans
Q8EGY7        86 MEVLFQEKQVYNSFFG-RCYLE---HADSQVRLLLENFCNY-VEMEVY-QVQVS 133 Shewanella oneidensis
WP_011865057  85 MDVLFLQKEVYSCFYG-KSHLR---EVDGLVQLLVQNFCSY-VDMEVY-QVQVT 132 Shewanella loihica
WP_013050620  88 IDICFNSNQVYSSLCG-WMCPQ---ECKELIKLFIENFISY-HSMDVY-QVRVS 135 Shewanella violacea
Q8EGY6        88 IDICFNSKQVYSLFSG-WIGER---ESQGLIKLFSDNFVSY-YQMEVY-QVEVS 135 Shewanella oneidensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap