Conserved Protein Domain Family
DUF2761

?
pfam10959: DUF2761 
Protein of unknown function (DUF2761)
Members in this family of proteins are annotated as KleF however no function is known.
Statistics
?
PSSM-Id: 371315
View PSSM: pfam10959
Aligned: 3 rows
Threshold Bit Score: 167.827
Threshold Setting Gi: 528862791
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KWT78802       7 PYPPGFVEPNTGRVAVLVREYAASDLNGDAPAYWYSAQSEEWGLDPWRLVEGVDPHTAGGQFDVCFANGSSRTVGPLMTF 86  Variovorax sp. ...
EPZ14341       7 PKAPGYVHPTTGRVAVLVADLAASDLNGDVPAYFYSEEAEGLGFDPWRLVEGIDAHTSGQDFDVCFDTGTYRTVGPLMTV 86  Thauera terpeni...
WP_046797599   6 PKQPGYVCPMTGRVAVLVKDYADSDLNGDAPAYWFNPEAEGWGMDPWKLVEGVDPHAQGSSMDVCFADGSSKTVGPLMTF 85  Rhizobium sp. L...
KWT78802      87 FMSAADAARLNAKK 100 Variovorax sp. WDL1
EPZ14341      87 FLSAADAARLAAEK 100 Thauera terpenica 58Eu
WP_046797599  86 FLTKTDAARLAAVR 99  Rhizobium sp. LC145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap