Conserved Protein Domain Family
DUF2625

?
pfam10946: DUF2625 
Protein of unknown function DUF2625
Some members in this family of proteins are annotated as ybfG however currently no function is known.
Statistics
?
PSSM-Id: 402500
View PSSM: pfam10946
Aligned: 12 rows
Threshold Bit Score: 270.332
Threshold Setting Gi: 296844152
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015034110    4 LSELTEVEDPAWPVLGEELRAASVPVEVLDPDGERGAa-ALLRTQVTVRSFLGAFLLHSGGAFVDDGWLRVYGSPADDND 82  Streptomyces
WP_012838293    4 LAELLERDEPALSLIQTWAQDASIPVECLPPSAQRDS--VLLALQVTTRSPLGAMAHGTGGILIDGGWLRMLGSGHPRLT 81  Comamonas thio...
Q881B9          4 LKDLVDHREPALPLVEEMLADASVNHQLLPSSAESSR--VLTRLQVITRSTLGTIAYHTGGLLIDHGWLRVLGSGHPLLP 81  Pseudomonas sy...
CAZ97432        4 LAELLNKDEPGWELVSEWMKDATNKVVILPKDEENAKl-ALYHSQVTTRSPLGAIIYETGGIVIDGGWIRILGSGDGKTS 82  Zobellia galac...
P44670          4 LEQLTSPEHSAWITLSQWIDNARNHCEVIKKDQSSAEr-ELFTMQMPTSSPMGAVIYETGGILIHYGWLRILGSGSFKLP 82  Haemophilus in...
CCB69232       26 tNELINHQESAWPSVKDWIAKAKNHVTILATDSINARq-ALYNTQVTTRSPMGAIIFNTGGLMVDQGWIRILGSGNEKLT 104 Flavobacterium...
ADO57765        6 VDELMDQDNHAWEEVRNILQEGNNPYRIVLAESESVRgdSLYRLQVSTKSYLGTVAYETGGIIFDHGWITLLGAGGPGVY 85  Paenibacillus ...
jgi:Ndas_0727   4 LSELVEVDEPAWPLLSERLERGGAAVRALPVDPERGRt-CLHRLQVTARSFLGAMALESGGLLLDGGWLRVHGGGGAE-- 80  Nocardiopsis d...
jgi:Caci_7299   8 LTELIEVDDPAWPELQALFAACPMPLTVFAPDSGESTr-GLRQLQVTARSMLGGLTLNTGGLLVDDGWVRVFGAGSGR-D 85  Catenulispora ...
Q9RI76         12 LNQLIDVEEPAWPELRETLGGGSVPVEVLPADTDVARt-SLLQLQVTARSYLGAVVLHCGGLVVDNGWVRVFGSP---LE 87  Streptomyces c...
P37003          4 MNQLVNTEDSAWPIIQNWLKDATNHTELLPVNKDLAEt-ALYQLQVTTKSPMGALVYGSGGLLIDNGXLRIAGSGHPRLP 82  Escherichia co...
WP_012684680    4 fEELYCEKDSAMDEIKKWQSASERKITLLPVELEKGKk-QLVDLQVTTRSTLGAVAFETGGILIHQGWLRILGSGHPHLP 82  Brevibacillus ...
WP_015034110   83 RRLPSLARVNDypadaaadpgwrpGAGLVVAHDVLGGVFVLQGGpaeevGLPGRPGEMVYFAPDSLRWDALGAGYGAWLS 162 Streptomyces
WP_012838293   82 RDLAAWNRARS-------------SGFLLIADDAVGGFFAINGG-----ALGEDLGAVHYLAPDTWAWESLEMGHTAFVQ 143 Comamonas thio...
Q881B9         82 RNLADWNEGRA-------------DGCLLVADDVVGGFFAINGG-----GLGDDVGEMYYWAPDTLKWEQLEIGYTDFLS 143 Pseudomonas sy...
CAZ97432       83 RTISDWNIGKSitef------geqAPFFLVADDVIGGFFAFNGG-----EFGQDLGQMYYFAPDGLEWEAMDMGYSDFIW 151 Zobellia galac...
P44670         83 RGLMDWNFSKSfses------gekPKYLLVADDVIGGYFALNGG-----SLGNNIGKIYYYSSKDLTWHNLNFTYTEFLA 151 Haemophilus in...
CCB69232      105 RSFSDWNKGKAfsaf------gnkADFLLIADDAVGGFFVLNGG-----KFDADLGKVYYFSPDNLQYEPLDMTYTDFLN 173 Flavobacterium...
ADO57765       86 GSLASWNGLQEpasv------palGGMLIVAYDAAGGFFGLDTG-----KFGRS-GHIYYFAPDALEWESTELAYSGFLS 153 Paenibacillus ...
jgi:Ndas_0727  81 --LPGLGEVNDlsaav----vygpPPRLVVAHDVLGGVFALNGPaaeggDYPGRPGEMVYFAPDSLEWEPLETAYSGWML 154 Nocardiopsis d...
jgi:Caci_7299  86 GNLPSLAQVNGfpetfd--pawqaAAGLVVAHDVLGGVFALNGMdpaaaGRPGQPGQMIYFAPDTLQWEALEIGHSAWVA 163 Catenulispora ...
Q9RI76         88 GAVPSLAQVNQfpgafd--sawqpDAGLVVAHDVLGGVFALNGGaparaGRPGAPGEIVYFAPDSLRWEALGAGHSAWLA 165 Streptomyces c...
P37003         83 RDPVSWTQRPEfa----------gVRALPIADDVAGVIFALNGG-----DLGEDTGCVYYFAPDTLNWESLEVGYSEFLQ 147 Escherichia co...
WP_012684680   83 RSITSWNQQCAl------------nGMLLVADDVIGGFFAINGG-----MFPDSVGGIWYFAPDSLAWEDLEIGYTDFLH 145 Brevibacillus ...
WP_015034110  163 WMLAGGTEEFYEGLRWPGWREEVRRLDGDRGLTLYPPLWs-EEAHrDLAATSRRVVTMAEV 222 Streptomyces
WP_012838293  144 WAFTGGLRDFYRDLRWEGWEAEVAGMGNDACMSFYPFLF--TEQG-SIHSSARKPVPAAEH 201 Comamonas thiooxydans
Q881B9        144 WALSDRIALFYDGLRWEGWRSDLEALGSDQCFSFFPYLW--TQEG-SIERSSRAMIDVIEQ 201 Pseudomonas syringae pv. tomato
CAZ97432      152 WTLRGDLEQFYKGLRWKNWREEIESLETDKGMGFFPFLW--TEYD-SINDLSRKPIPMHEV 209 Zobellia galactanivorans
P44670        152 WVLNGDVEAFYQGLFWKNWQDDVKQLDGNQVFVFTPDLN--QDRKiAIDERQKQEVNIETH 210 Haemophilus influenzae Rd KW20
CCB69232      174 FCFNANLDQFYKNLRWPNWQKEVSTLHGDSVFSFYPYLW--SQEGqHLQTNTKKIVPIEEQ 232 Flavobacterium branchiophilum FL-15
ADO57765      154 WLAEGDLGLFYQTFRWNGWQSDMEQLQPGEIFAYYPPLW--TQEG-GGETSHKSPIAITEA 211 Paenibacillus polymyxa SC2
jgi:Ndas_0727 155 WLLDGHLEDFYRALRWPGWREETEALDLTLGLSLRPFPWt-SEARqDMAATSRRPIALGEl 214 Nocardiopsis dassonvillei subsp. ...
jgi:Caci_7299 164 WLLSERLEGFYSALRWDGWREEAAAAGPAEGISVFPFLW--SKQAeDVATTSRRTVPMSgv 222 Catenulispora acidiphila DSM 44928
Q9RI76        166 WLVSGALAELYTDLRWTGWQDEVRALNSDQGLSLFPPLWs-AEARqDISATSRRAVPMAEL 225 Streptomyces coelicolor
P37003        148 WALSGDLDTFYENVRWQQWREDVIKLSATEAFTFYPFLW--VQSE---EARTRKVISLTEL 203 Escherichia coli K-12
WP_012684680  146 WAMTGDIHTFYETFFWTDWEKDVSELKGNEMFEIYPFLWskEARElTMDGCSKKPVSALEI 206 Brevibacillus brevis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap