Conserved Protein Domain Family
CBP_BcsR

?
pfam10945: CBP_BcsR 
Cellulose biosynthesis protein BcsR
CBP_BcsR is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation).
Statistics
?
PSSM-Id: 402499
View PSSM: pfam10945
Aligned: 8 rows
Threshold Bit Score: 67.3996
Threshold Setting Gi: 549069905
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAN96867            16 DQDDINALSDAFSLKAFRYIDIAREARLQQLLSRWPLLQECT 57  Plautia stali symbiont
WP_013204396        15 SQDDIRALADAFSLQHWRYIDIAREERLAAIVARWPLLAERA 56  Erwinia billingiae
Q6CYY5              22 SDDDLRVLSQAFSLPEINYIDIARQTRLSQMMARWPLLDELK 63  Pectobacterium atrosepticum
goetting:EBL_c01460 18 FENDFLALQRIFALPDIHYSDISQNERLSAALQRWPLLAEFA 59  Shimwellia blattae DSM 4481 = NBRC 105725
wugsc:CKO_04979     19 FQNDFLALSQAFSLPEIDYTDISQREQLAAAIKRWPLLAEFA 60  Citrobacter koseri ATCC BAA-895
Q88JL6              11 RSDDIAQLRQHLDMPELNYQDISMLVGVQQALQRWPLLGESC 52  Pseudomonas putida KT2440
jgi:Fraau_2361      15 RTDDIARLKQHLHASGMVYHDFAREQRQTSVVHRWPLLGELA 56  Frateuria aurantia DSM 6220
CAR44190            18 tNQDINKLKKLFSINNYHYRDINNEENQHSLIYRWPLLNTFn 59  Proteus mirabilis HI4320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap