Conserved Protein Domain Family
DUF2712

?
pfam10916: DUF2712 
Protein of unknown function (DUF2712)
This family of proteins with unknown function appear to be restricted to Bacillales.
Statistics
?
PSSM-Id: 402480
View PSSM: pfam10916
Aligned: 6 rows
Threshold Bit Score: 147.683
Threshold Setting Gi: 366983027
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCY70134      31 ARDDNVEYAFKLQANYKNSYTDIRYRQTKKADNPWKVNMTYSAE-GKGTK--AVYWLNVPGLFCTseRVSNTHTVKQGSG 107 Eubacterium sp....
CDC32443       5 AGNDNVAFSFTMKANSARNYTGDRYRETTRTNNPWKVNMTASTE-GKHTQ--AYYFLASNGIRRI--QYSDQHLVKSETG 79  Eubacterium sp....
EHN58426      28 ASDNNIGFAFTIQSYQEESTTGWRYRQTKSTANPWKVGVYTSTE-GNGSYysAHLYGSQNGA-----LASPTKNAYTGPA 101 Oenococcus kita...
WP_012576275  30 ASDDNIGFSFELKPNYGNSYSESRYRQTTDPNNKWKVNLTYSSE-GVGSI--ATFWLDKSGT-----RVSDTHDIKQGSG 101 Anoxybacillus f...
WP_014940790  27 SADVDTVFDFKLGMFKGNGQTEDEYR--SNTSKPWMVNMQHDTEkGSNSV--ATYWIENTGLLNR--NVSKSYDIHEGSG 100 Lactobacillus b...
P37490        30 ASNDNYKFHLLVPYGYGNAYSNDAFRQTTHTDNPWKVNLQKSAE-GKGTI--MTFWLINTGNSKIp-KASKIHNVKQGSG 105 Bacillus subtil...
CCY70134     108 -PHYYK-AWKGAAQQYVSMGAENNNNTSKTYNVSGYWDEETW 147 Eubacterium sp. CAG:161
CDC32443      80 -DHRYK-AYAEASKQGVSLGCKNNNNVNKSYTVAGYWDEETG 119 Eubacterium sp. CAG:251
EHN58426     102 yPYVYSgAYSNASQQNVRMAVFNPTWTPSVFYITGAWDEETW 143 Oenococcus kitaharae DSM 17330
WP_012576275 102 -AHYYS-AFSTANQSNVRLGAENNNYSPDSYVISGYWDEETN 141 Anoxybacillus flavithermus
WP_014940790 101 -EHKYS-ANSDANGALIALTAQNNNLNANEPEVSGYWNPE-D 139 Lactobacillus buchneri
P37490       106 -AHYYH-ANSQGSHTYVALAVENNNYSASSYGIDGVWDEETW 145 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap