Conserved Protein Domain Family
DUF2709

?
pfam10915: DUF2709 
Protein of unknown function (DUF2709)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402479
View PSSM: pfam10915
Aligned: 5 rows
Threshold Bit Score: 405.759
Threshold Setting Gi: 14195443
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6MEP2         4 VVITDEQKKMLEQFLDENRPAELINTYLHFIESKFQLQPVLFPKDKIIYQSAEDCIKNLEREGKLWHETEIKIGFGHASV 83  Candidatus Prot...
WP_013182754   4 VIISEEAKSLLDKFLEENRPAPLVNTYLFYIENKFNLQPVLFPKEKMIYQSAEAAIRRLEEEEKIWHQTEIKITFGETSV 83  Waddlia chondro...
CCB87710       4 VVISDEIKTALLHFLQENPHADLVTTYLRYVEKKFNLSPVLFPKEKTIFQSTDQAVNFLEKEGKLWHEAEIKIGFSNLSV 83  Parachlamydia a...
WP_013944549   5 V-ITKSLKDLLADFLKNNKKADLLTTYFFFLEKKYNIQPVLFLREKTIYQSKEEILKKAEEEGKLWRETEIKIQVGTPAV 83  Simkania negeve...
O84543         1 MNISGSIKQKLLQFLKKQKSPELLATYLFYLEQSLHLSPVVFVRDKIIFKSAEDAIQLLEADKKIWRETEIQISSGKPEV 80  Chlamydia trach...
Q6MEP2        84 NEETKKVYICPFTGKVFGDNTHPNPQDAIYDWVSKCPENTERIGGLRVKRFFVSEDPEVIKSYIDKTKsRRDAIKKVVYS 163 Candidatus Prot...
WP_013182754  84 NEQTAKIYICPFTGKVFGDNTHPNPQDAIYDWVSKCPENTERSGGLRVKRFFVSEDPEVIKNYMNKEQ-RKDPITKTVYS 162 Waddlia chondro...
CCB87710      84 NEGTKKIYICPFTGKVFGDNTHPNPQDAIYDWVSKCPENTERVGGLRVKRFFVSEDPDVIRSYISKTK-TKESITKAVYS 162 Parachlamydia a...
WP_013944549  84 NEGTKKIYICPFTGKVFGDNTHPNPQDAIYDWVSKCPENTERIEGMRVKRFFVSEDPEVIKNYIQK---RKEPITKIVFS 160 Simkania negeve...
O84543        81 NEQTKRIYICPFTGKVFADNVYANPQDAIYDWLSSCPQNRERQSGVAVKRFLVSDDPEVIRAYIVP---PKEPIIKTVYA 157 Chlamydia trach...
Q6MEP2       164 SVLSGKLFNSKEAVIEDFKRNYLKKLSLVEVQIQNKFKIEDHFLAFIQKHLVEDKIASFVEALAEFDEFLPYVERWV 240 Candidatus Protoch...
WP_013182754 163 SVLSGKLFNSKEAVIKDFRKNYLKKLTLVEVQNQNKFSIEESFLEFIQQQLVEDKITGFVEAMAEVPEFLPVVESWL 239 Waddlia chondrophila
CCB87710     163 SVLSGKLFSTKQAVILDFEKNYLKKLSLVEVQNQNRFQIEESFLNFIQKQLEEDKIASFVESVAEIEDFTPFVEQWI 239 Parachlamydia acan...
WP_013944549 161 SGLTGKLFNSKKAVIEDFETNQLKPMPLLDVPSQNRFQIETHFLSFIEEQLDESKITAFVEAMSEHDEFSTHVERWV 237 Simkania negevensis
O84543       158 SAVTGKLFHSLPTLLEDFKTSYLRPMTLEEVQNQNKFQLESSFLTLLQDALEEEKIAEFVESLADDTAFHKYISQWV 234 Chlamydia trachoma...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap