Conserved Protein Domain Family
DUF2717

?
pfam10911: DUF2717 
Protein of unknown function (DUF2717)
Members in this family of proteins are annotated as gene 6.5 protein however currently there is no known function.
Statistics
?
PSSM-Id: 151358
View PSSM: pfam10911
Aligned: 4 rows
Threshold Bit Score: 124.535
Threshold Setting Gi: 75086333
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q859F4            1 MLKVIQHHIQNPDDIPDIAPAAAEYLAVRLNASYLIATGIVDDLRKQGYSEGYIAGFLDGANAAveiTELMQEAQ-LQKE 79  Pseudomonad ...
REF_wim:AS5_0032  1 MLTPINQLLKNPNDIPDVPRATAEYLQVRFNYAYLEASGHIGLMRANGCSEAHILGFIQGLQYA---SNVIDEIE-LRKE 76  Enterobacter...
Q9T113            1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQTYVMESGEYRALRAAGYSESFIAGVMHGLYLA---SRTLDEIE-VRKE 76  Yersinia pha...
CAJ70675          1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYA---SQTLDDMEaIRKE 77  Yersinia pha...
Q859F4           80 E 80  Pseudomonad phage gh-1
REF_wim:AS5_0032 77 Q 77  Enterobacteria phage 13a
Q9T113           77 Q 77  Yersinia phage phiYeO3-12
CAJ70675         78 Q 78  Yersinia phage Berlin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap