Conserved Protein Domain Family
DUF2691

?
pfam10903: DUF2691 
Protein of unknown function (DUF2691)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371294
View PSSM: pfam10903
Aligned: 7 rows
Threshold Bit Score: 184.13
Threshold Setting Gi: 503254774
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65G03         4 KRGVLFEIPNGYGRFLLDILKP-VEPADFNWLLADGECYLVENGELsdENLFPQDPQVMTGEAFKKRL--EDARYYLIFA 80  Bacillus lichen...
WP_015734821   2 KRGISFEIPNEYGRFLEDILKP-FKVEDYDWWIGGEESYIILDGKL--DALFSGLIECMEGETLRNVI--KNNDYYLIFQ 76  Paenibacillus s...
WP_009791907   2 IRGMTFEIPNEYGRFLFEILLA-LKASSFEWMIAGEEGYFIENGELg-RELFPENKMVMAGGDLMLYL--SPYTCYLIFA 77  Bacillus
Q81BR8         2 KRGLTVDILDGYDNLLWKVLKP-IDITVFDWRVRDEESYLIARGELd-EALFPEEPSVVEGLALKKLV--KDNIYYLIFA 77  Bacillus cereus...
P94495         2 NRGVSFQIPNEYGNFLWRILQP-VEIANYRWQTSG-ESYFVVEGELddEELF-HDYEIVEGAVFEQQL--KTNQYYTIFV 76  Bacillus subtil...
WP_013489435   3 riGLIFSIPNEYNQVLLKLLEDvLDIPSYWVRGPHEEIHFPGDSs---TSFFNEEESILDNIRIKETLlsVKHDYYPIFS 79  Bacillus cellul...
BAK17081       1 MRGLSFEIPNQHGRYLYEILEA-IDIRAYFWKSEAEEAYYIENNQLd-EAMFPQPY-TYTGEELYNRI--SVKDYYVLFT 75  Solibacillus si...
Q65G03        81 DLKAFPKDGHPEDVSTYESYMKSSCELIVLTADSSFVTIYCKDQKNLELLYQNAKDCGFKRIEYITDHNDARTGMH 156 Bacillus lichenifor...
WP_015734821  77 DLKAFPKGSKPIEIKTYDEFLKSNCELALLVVDSSYTTIYCKNDELVEGLYSNARNQDYTNIEYITDENDFRTGLT 152 Paenibacillus sp. Y...
WP_009791907  78 DLKAFPKGKAADDIRTYKDFLKSDCQIAILIVDSSYTAVYCKDRERTERLYRFCRE-RFSNAEYIKDEND-RNELA 151 Bacillus
Q81BR8        78 DLKAYPKGEIAIDIETYEEFKESKCEVVVLAVDAQYIQIYAKDQKSIELMYENAVNQGFY-VEYITDENDGRTRLS 152 Bacillus cereus ATC...
P94495        77 ELKAFPYGKMVNQVNTYEEFADSDCELVLLIADNSYVSIYCKNKNIIEKLYFNALQHDFEDVQFITDENDTRTSLT 152 Bacillus subtilis s...
WP_013489435  80 KFSIYESKILEKDSNNLEDFLHSRSHTVICISDVTQFMVVSKCLSIINSFEKIYEKYGYTDLEYIYYEkhkdtlrl 155 Bacillus cellulosil...
BAK17081      76 DLKAFKDKLHVQDIATYEEFLNCQCEIVLLIVDSAYVTIYVKDQHVTERIYRKAVQNRYENIVYITDENDLRTTLT 151 Solibacillus silves...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap