Conserved Protein Domain Family
Cyt_b-c1_8

?
pfam10890: Cyt_b-c1_8 
Cytochrome b-c1 complex subunit 8
This entry represents subunit 8 of the Cytochrome b-c1 complex.
Statistics
?
PSSM-Id: 371286
View PSSM: pfam10890
Aligned: 8 rows
Threshold Bit Score: 102.893
Threshold Setting Gi: 158274330
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001420616  1 MAKVPARLRSVTYSLSPMRTGVMHGLFKDWASGMATRVkENAVDAGVFcALPLGATVWYALNYKENEKLEHRY 73  Ostreococcus lucimarinu...
XP_002503991  1 MGRSAVRLSEVVYTVSPMKTGVLGGLFKDWPKVMAKKI-GGWGDAFFFgVIPTVGVYQYAVNYKENEKQSHRY 72  Micromonas commoda
XP_001776082  1 MGKVPVRLKEVAYTISPYHQHVMTGLWKDIPYKLSKKFhENWVSAFTL-VVPIVGTYMYAENYRENEKLHHRY 72  Physcomitrella patens
XP_001762022  1 MGKVPVRLKEVTYSLSPCHQHIWRGLLHDVRYKTMKRFnDNWVSALFL-LVPVLGSYGYAEAYREREKLHHRH 72  Physcomitrella patens
XP_006344090  1 MGKQPVKLKAVVYALSPFQQKIMPGLWKDLPGKIHHKVsENWISATLL-LGPLVGTYSYVQHFLEKEKLEHRY 72  potato
XP_015644404  1 MGKTPVRMKAVVYALSPFQQKVMPGLWKDITTKIHHKVsENWISATLL-LAPIVGTYEYAMYYKEQEKLSHRY 72  Japanese rice
EDP00113      4 RQNIP--LREILYQLSPYQQDVIRQTFTNAPKTFLRFFkEKGVGLATF-GVLFFGIKGYTEHEMHQERLAERY 73  Chlamydomonas reinhardtii
XP_002986781 12 PGVVAVRLREVVYTLSPNHLKIMPGLWKDLPEKIKHKL-ENWHYGVLV-AVGFYGPVWFCKHSVHQRELSHRD 82  Selaginella moellendorffii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap