Conserved Protein Domain Family
DUF2746

?
pfam10874: DUF2746 
Protein of unknown function (DUF2746)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 371279
View PSSM: pfam10874
Aligned: 2 rows
Threshold Bit Score: 216.507
Threshold Setting Gi: 465152
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q05239   1 MTPFNPDSIGDYVTLLGVAFLTFSVPAWFTGRARKHSSDIGEIKEQVCNTHDTNLRDDLDSVKADISDLKEIVLQGFHQV 80  Mycobacterium virus L5
Q05239   1 MTPFNPDSIGDYVTLLGVAFLTFSVPAWFTGRARKHSSDIGEIKEQVCNTHDTNLRDDLDSVKADISDLKEIVLQGFHQV 80  Mycobacterium virus L5
Q05239  81 NESINLERRERIEGDRRKEVA 101 Mycobacterium virus L5
Q05239  81 NESINLERRERIEGDRRKEVA 101 Mycobacterium virus L5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap