Conserved Protein Domain Family
RGI1

?
pfam10843: RGI1 
Respiratory growth induced protein 1
This family of fungal proteins includes RGI1, standing for respiratory growth induced 1. RGI1 is involved in aerobic energetic metabolism.
Statistics
?
PSSM-Id: 371266
View PSSM: pfam10843
Aligned: 10 rows
Threshold Bit Score: 337.121
Threshold Setting Gi: 74602743
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A3LTT0         3 RAKKsKDSQPLDLNNCQPLEHLQPVPKTRSASIISVEStdSeGGVVEVLAPPQVREFDDLTAFEAFVRDETWDNDFDYFH 82  Scheffersomyces...
Q6BT37         3 KKNK-NQTLALDLDNCEKLTQLKEIPKSRSSSITSIES--E-GSIQSVLKPPPMREFEDVVAFESYIRDETWDNDFDYCH 78  Debaryomyces ha...
CCE82429       4 KANKkSKAVELDLNNCERLEHLKEVPKSRSSSITSIES--D-GSLQKSIKPPPMREFEDLTSFEAYLRDETWDNEFDYCH 80  Millerozyma far...
EGV64934       3 KKER-KNSVTVDLENCDKMQHLKPIPKSRSSSITSIES--N-GSFESVLRPPPMKEFDDLRAFEAYIRDETWENDFDYLH 78  Yamadazyma tenu...
XP_007374429   6 KKSK-SQSLPLDLDNIQPLEHLQPVPKTRAMSITSIESadEpSGMKQVLVPPPIREFDELEQFEAFVRDETWDNEFDYFH 84  Spathaspora pas...
CCE44620       6 KKNK-SDAVPLDLDNIKPLEHLQAVPKARSSSITSVESveEpGVVKQVLVPPTIREFDELEQFEAFVRDETWDNEFDYFH 84  Candida parapsi...
Q59KG2         5 KKSK-SEALPLDLDNIKPMDHLQPVPKTRSSSITSIESadEpGTMKQVLLPPTIKEFDELEQFESFVRDETWDNDFDYFH 83  Candida albican...
EMG46253       5 KKSK-SEYEPLDLDNIKPLDKLQAVPKSRSSSITSIESaeApGTMMQVLAPPMIREFDELEQFEAFIRDETIDNEFDYYH 83  Candida maltosa...
A5DE59         5 KSKSgRMTTALDLTTCEKLEHLQPIPKSRSSSITSIES--EdGMMSTVLKPPPRRDFDDLMAFEGFIRDETWDNDFDYCH 82  Meyerozyma guil...
C4Y451         3 KGKK-KQTVELDLNKVEKLEHLMPVPKSRQSSITSVES--EdGSLKEVLKPPPRKDFEDLASFESYIRDETWDNEFDYCH 79  Clavispora lusi...
A3LTT0        83 GRLNYYPPFIMKECHDNLDKIKPTANKNSRKFKRNLQHHVARHLIKDLEKCCGYELHMDKFDTIETPNRITWKFKDESDH 162 Scheffersomyces...
Q6BT37        79 AHLSYYPPFITKEVHGNMDKIKPTMNKKSRKFKRNLQHHIQKHLMPEMEKCSGFTMDFGKAGVEETPTMLKWKFEDTSDH 158 Debaryomyces ha...
CCE82429      81 AHVMYYPPFIMKTVHNDFEKIKPSMNKKSRKFRRNLEHHVKKHLMTEMERCSGFKMDFDKVGLEDNPSLLKWIYEDTSNH 160 Millerozyma far...
EGV64934      79 AHLKYYPPFILKECHENLDKVKPTANKNSRKFKRNLQHHVQRHLMKEMAICGGYNMDFKRVDVRETPKTMVWTYEDSTDH 158 Yamadazyma tenu...
XP_007374429  85 GRLNYYPPFVMKECQNNPEKIKTTTNSNSKKFRRNLQHHVKNHLVKDLERCCGYELNFDKAEVVEAPGKVTWKFRDHSDH 164 Spathaspora pas...
CCE44620      85 GRLHYYPPFVMKECHDDVEKIKPTTNKNSKKFKRNLQHHIQKHLIKDLQKCCGYELNFDKGEMTESFDKLSWTFKDETDH 164 Candida parapsi...
Q59KG2        84 GRLHYYPPFVMKSCQNNLEKIKPTMNKNSKKFRRDLQHHIQKHLIKDLEKCCGYELNFGKGEVVETDNKVTWKFKDETDH 163 Candida albican...
EMG46253      84 CKVRYYPQVILKASHNEVEKIKPTVNKNSKKFRREIQHHI-KHLTKDLEKCCGYELNFGKPEIVETDKIYAWKFKDETDH 162 Candida maltosa...
A5DE59        83 AHLTYYPPFIMKEVHNNLDKIKPTMNKNSRKFKRNLQHHIKKHLMHDMETCSGFKMDFNKVGMVETPTKVKWRFEDMGDH 162 Meyerozyma guil...
C4Y451        80 AHLTYYPPFVLKEVHDDIEKIKPTMNKNSSKFRRNLQHHIQRHLILEMEKCCGFEMDFGKAKMEETPKNIIWRYEDSGDH 159 Clavispora lusi...
A3LTT0       163 GFSKEEEDEYNRHWRLELSVSCNNENPMVEVDYKAIP 199 Scheffersomyces stipitis CBS 6054
Q6BT37       159 GFSKEEENQFDRHWKLQLEVTCNNENPLVEVDYMAIP 195 Debaryomyces hansenii CBS767
CCE82429     161 GFDDDEAQRFHRQWKVHLEVSCNNENPMVEVDYQAIP 197 Millerozyma farinosa CBS 7064
EGV64934     159 GFNPEEEDAFNRHWKLQLEVCCNNENAMVDVDYRAIP 195 Yamadazyma tenuis ATCC 10573
XP_007374429 165 GFSKEEEDKYNRHWTLELDVSCNSESALVEVDYKAIP 201 Spathaspora passalidarum NRRL Y-27907
CCE44620     165 GFSKEEEDLYDRHWKLQLDVTCTNDSAMVDVDFKAIP 201 Candida parapsilosis
Q59KG2       164 GFSKEEEDMYDRHWRLELDVSCTNESAMVDVEYKSIP 200 Candida albicans SC5314
EMG46253     163 GFSKEEEDLYDRHWKLELEVTCTNESAMIDVDFKSIP 199 Candida maltosa Xu316
A5DE59       163 GFSKEEEDMYGRHWKLELEVTCNNENPLVEVDYKATP 199 Meyerozyma guilliermondii ATCC 6260
C4Y451       160 GFPKEEEDKFNRHWKLELEVSCNNENPLVQVDYKAIP 196 Clavispora lusitaniae ATCC 42720
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap