Conserved Protein Domain Family
T7SS_ESX_EspC

?
pfam10824: T7SS_ESX_EspC 
Excreted virulence factor EspC, type VII ESX diderm
T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313;
Statistics
?
PSSM-Id: 371259
View PSSM: pfam10824
Aligned: 21 rows
Threshold Bit Score: 59.2781
Threshold Setting Gi: 119953929
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5YTI6            5 SMENLSVDTGAVRAFATEHAGIAGQISAAANMDlvGQVSALTPVFGLIGADYLLSFAAAQVLQAKDINDLAAKYNDLSWK 84  Nocardia far...
CAM06012          1 MADEMNVVIEGLRSHASKVDGVVDRLNTAVDAS--REVTLNNDAYGILCQPFALMIESVEQNGVETLRKAVDAMREVADN 78  Saccharopoly...
Q744T9            1 MADSIHVVPAHLRQAAAHHQDTSEYLRTVPSSH--AAIQESLDSLGPIFSELRDAGRELLELRRQCYEQQAADHADLADQ 78  Mycobacteriu...
jgi:Mvan_0083     1 MSAPLEVDTSVMRRVGSDFDSAGDRMAGLQADAplGDAAAAVPQ-----LQTAAACNAARTTVATEMTKIAGSARTYGAD 75  Mycolicibact...
VBC:MMAR_4349     1 MNEILTLQPDVISRLSQGHDATVTGLQAATAAPa-GISANVATTHGTFTSEFNNALSEFEAVRARAGQALQGVATGLSKN 79  Mycobacteriu...
P9WJD1            1 MTGFLGVVPSFLKVLAGMHNEIVGDIKRATDTVa-GISGRVQLTHGSFTSKFNDTLQEFETTRSSTGTGLQGVTSGLANN 79  Mycobacteriu...
Q5Z2J0            9 SATTLFVVPEKVGEVGKYLYELAQALQAALDSA---AQDVSSLTDGSWTGDHATDFANAWADLRTSGDQIMAALTELAEK 85  Nocardia far...
WP_011731246     34 TNPELHVTPAEVRRSADQMDVVAHEASSSRTAM----ADGISGQTTAWKEAGTPGFAKFVDIAHSQAERLRTDLTGLRDR 109 Mycolicibact...
tigr:MSMEG_5101   1 MN-QVIANTGAMNSWQQQLGEVSSGVGNLLNGT--PGVSDVMNTHGTIGFPMQSAFDAAHAARGGAMGATQAASSKISDL 77  Mycolicibact...
WP_011781665      1 MTEPLSVDADGVRSLGEIHNRVAAGLGSLAAAS--PGPAAVAGSHGTIAAAVDTALTGALGSRSGTLAGTRTAGDTISEL 78  Mycolicibact...
Q5YTI6           85 AFSAAALFENTDGENAGQLNV 105 Nocardia farcinica
CAM06012         79 VRATAEEYQAVDDDNSSMLGE 99  Saccharopolyspora erythraea NRRL 2338
Q744T9           79 LTVSAAMWEQHEQEAADKFGS 99  Mycobacterium avium subsp. paratuberculosis
jgi:Mvan_0083    76 LRSAADRYDATDETSGRAIDG 96  Mycolicibacterium vanbaalenii PYR-1
VBC:MMAR_4349    80 LNKALTAYVNTDRAGAEILDq 100 Mycobacterium marinum M
P9WJD1           80 LLAAAGAYLKADDGLAGVIDK 100 Mycobacterium tuberculosis H37Rv
Q5Z2J0           86 LGVTAHTYQARDENNAGAIQN 106 Nocardia farcinica
WP_011731246    110 LRTAADVYERRDHEAGGALDS 130 Mycolicibacterium smegmatis
tigr:MSMEG_5101  78 LRQAAQAYERGDVTAADDLKK 98  Mycolicibacterium smegmatis MC2 155
WP_011781665     79 LHQAALAYERGDHRGAEAIRT 99  Mycolicibacterium vanbaalenii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap