Conserved Protein Domain Family
DUF2543

?
pfam10820: DUF2543 
Protein of unknown function (DUF2543)
This family of proteins with unknown function appear to be restricted to Enterobacteriaceae. The family has a highly conserved sequence.
Statistics
?
PSSM-Id: 402446
View PSSM: pfam10820
Aligned: 5 rows
Threshold Bit Score: 129.617
Threshold Setting Gi: 455422187
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004180069  1 MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGN 80  eubacteria
Q6D6U9        1 MNNEVSLKYYDIVDEYSTESAEPVSESERESLARYFQLLITRLTNNEEISENAQKEMASEAGIDERRIDEIATFLNQWGN 80  Pectobacterium a...
WP_013202714  1 MNNEIALKYYDIADDYVAESAKPVSEPQRDALAHYFQLLLTRLSDNQEISEDTQNEMAREAGIDEQQIDGIANYLNEWGN 80  Erwinia billingiae
CCH:MU9_3473  1 MENIVPDKYYDIADEYALESEEPVEEQEYDGLAHYFQLLITCLTNNEEISEEAQKKMAAEAGINKQRIDDIAEFLNRWGN 80  Morganella morga...
Q32FZ4        1 MNHDIPLKYFDIADEYATECAEPVADAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGN 80  Shigella dysente...
WP_004180069 81 E 81  eubacteria
Q6D6U9       81 E 81  Pectobacterium atrosepticum
WP_013202714 81 E 81  Erwinia billingiae
CCH:MU9_3473 81 D 81  Morganella morganii subsp. morganii KT
Q32FZ4       81 E 81  Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap