Conserved Protein Domain Family
DUF2561

?
pfam10812: DUF2561 
Protein of unknown function (DUF2561)
This family of proteins with unknown function appears to be restricted to Mycobacterium spp.
Statistics
?
PSSM-Id: 402442
View PSSM: pfam10812
Aligned: 6 rows
Threshold Bit Score: 222.781
Threshold Setting Gi: 119957350
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Mvan_3561       8 TRTRR--GFD-VAALDRTDRILLGAAVVVWLAALGAGVAATVALVDLSRGHVESAADSGTPWVLYTIIGISAAVIVAAVP 84  Mycoliciba...
P9WLI9              6 SAYRR--GPD-VISPDVIDRILVGACAAVWLVFTGVSVAAAVALMDLGRGFHEMAGNPHTTWVLYAVIVVSALVIVGAIP 82  Mycobacter...
Q9CCE8              6 SPYRR--GSD-TIASDVIDRILVGVCAAVWLVLIGVSVAAAVALEDLGRGFHKIASDPHTTWVLYGIIVVSVLIIAGAVP 82  Mycobacter...
Q73YL8              6 SAYRRglGDD-TVSPEVIDRILIGACAAIYLALLGVSVAACVALADLGRGFHKAASSPHTTWVLYAVIIVSALIIAGAIP 84  Mycobacter...
MSJTU:JDM601_1705   8 IADRF--GHP-GQSPEVTDRVLLGVCAAIWLALLGMSVAATVALVDLGRGFDQPTESSHTG-LLYIVIGVSALVILAAIP 83  Mycoliciba...
VBC:MMAR_3241       6 SAYRR--GPEgVVAPEVVDRVLIGACAAVWLALVGVGVAAVVALADLGRGVQKISKDSHSSWVLYAVIVVSALIIVGAVP 83  Mycobacter...
jgi:Mvan_3561      85 LLLRARRTAEADa-----PAAPQRPVTETAPPPpaRGIDAPTEKlraARPSEG-SGPLPRALRSSAAPVSAVTDQVFLRC 158 Mycoliciba...
P9WLI9             83 VLLRARRMAEAE------PATRPTGASVRGGRS--IGSGHPAKR---AVAESA-PVQHADAFEVAAEWSSEAVDRIWLRG 150 Mycobacter...
Q9CCE8             83 VLLWARRVARVE------PPIRPAGVPERGGVRqlVSAGRSTAR---IEVERVcAEERVQSVAQPGEWFDAAVDRIWLRG 153 Mycobacter...
Q73YL8             85 ILLRARRISQAE------PTARAMTAPARPPVRlgAGVARPATE----------RAPHAPATTPDVGWSGEAVDRIWLRG 148 Mycobacter...
MSJTU:JDM601_1705  84 VLLRARQAGPARrsagfaPPAAAGPRPRPGAPLpqRGFDAPGRR--------------SAATRPALLPNQAQVDRVLLRG 149 Mycoliciba...
VBC:MMAR_3241      84 MLLRARRMAETGplvtsvPLRRTGGQPLRTANAtmRAADRSARR------------DHANGRSEGTQWSSEAVDRVWLRG 151 Mycobacter...
jgi:Mvan_3561     159 TASIASAMGVATLLVSVSTYLMAVDSDTAAWVLYGVVGVVTVGMVAIPWYFLRELR 214 Mycolicibacterium vanbaalenii PYR-1
P9WLI9            151 TVVLTSAIGIALIAVAAATYLMAVGHDGPSWISYGLAGVVTAGMPVIEWLYARQLR 206 Mycobacterium tuberculosis H37Rv
Q9CCE8            154 TVGLTGTMGAALVAVAASTYLMAVGRDGASWVGYVLAGIVTAVMPVIEWIYVRQLR 209 Mycobacterium leprae
Q73YL8            149 TVILTGTMGAALIAVATATYLMAVGHDGSSWVGYGFAGVITAAMPVVEWLHIRQLR 204 Mycobacterium avium subsp. paratub...
MSJTU:JDM601_1705 150 VTVLGSAFGGALTMVAAATYLMAVGKDTGSWVCYGLAGAITLAMPVIPWLYLRRLg 205 Mycolicibacter sinensis
VBC:MMAR_3241     152 TVALVGTIGIALIAVGAATNLMAVGHDGASWVAYGLAGIVTAGMPAIEWFYVRQLR 207 Mycobacterium marinum M
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap