2EFV


Conserved Protein Domain Family
DUF2540

?
pfam10802: DUF2540 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF2540)
This family of proteins with unknown function appears to be restricted to Methanococcus.
Statistics
?
PSSM-Id: 402437
View PSSM: pfam10802
Aligned: 4 rows
Threshold Bit Score: 100.631
Threshold Setting Gi: 158428303
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EFV_A       14 TFYLYKNIDGRKLRYLLHKLENVENVDIDTLRRAIEAEKKYKRSITLTEEEEVIIQRLGKSANLLLNCE-LVKLD 87  Methanocaldococcus ja...
Q6M002        6 HLNLIEEIDAIAVRYFLHQIQNLESVDVEKLGKASKLPKKCSRTLKLSEEEQKIIKKAGKLTGHLVNYViLTERE 80  Methanococcus maripal...
Q6LZ85        6 TLGLIENVDRRTARYILHKVEDMNAISPDILKKATEPKKQFRKTLSLSDIEKKIVEKHGKATSLLMNCYiVMNRE 80  Methanococcus maripal...
WP_013180928  4 yFNLYKNIGARELRYYVHKMENCENIAPETIAEIKNRNLKTKKLLTLSDKENEIVSRYGIGANFLLNCIiFQEEE 78  Methanococcus voltae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap