Conserved Protein Domain Family
DUF2605

?
pfam10792: DUF2605 
Protein of unknown function (DUF2605)
This family is conserved in Cyanobacteria. The function is not known.
Statistics
?
PSSM-Id: 402430
View PSSM: pfam10792
Aligned: 37 rows
Threshold Bit Score: 95.011
Threshold Setting Gi: 427344885
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015187005        6 LPEPELLKTILQPLLEDFQYWFERSRHLLETEQIAFLDQQQQFDLLERVKQAQQEVNSAQMLFQVTGGQVGIDMAAIMPW 85  Gloeocapsa...
P73889              6 PDEKELLKTILEPLLGDFEHWFSRSCQLLESQRLVFFTPEQQQELLDRVRQARDEVKCTKLMFQATGEQVGVEFSVLVPW 85  Synechocys...
WP_015227364        5 SEQKQLLKAILEPLLEDFQYWFSRSRNLLESEQVAVLSPAEQADLLQRVKTAQEEVSATQSLFQATDGNVGVEMSTIAPW 84  Halothece ...
WP_012306987        7 ADEKQLLKAVLAPLLDDFLYWFDLSLTALEKKSLSFMAPAEQEDLIARIRQAQGEVMATKSLFQATDGNAGVDVQVLMPW 86  unclassifi...
Q31M52              7 pAQPELLKAILEPLLDDFLFWFDRAEQLLTKESIDFLTPEEQAALCNRLAVATAEVRSTQALFKAMDGSIGIEVAVMKPW 86  Synechococ...
Q2JMF4              7 MSKSELLREILGPLLEDYRYWFERSRRFLQEETLELISPEEQQSLLEEVLAAQAELQVAKALYQASDQEVGIDPGLMAKW 86  Synechococ...
CAK23203            7 PEADALLETLLDSLLKDFNHWFRRGEELLEVCPDVVMDGAAREAMAARLTEGLRAIEATRALVNASPEAMAVSMEAMAPW 86  Synechococ...
WP_015164207        6 SQNTELMQQVLEPLLEDFIYWFDRSISMIENERLSFMTEAEQAELLSRVKEKLREVQSANLLFKATDKQVGVDVKAMVPW 85  Pseudanaba...
jgi:Syn7502_00298   6 fPDAEVLKNIFEPLLEDFEYWFGRSLVLLEEEELDFMTDIQKHDLITRVKDTLQAVQTVKMMYKLSGEQVGIEVQALMPW 85  Synechococ...
EKQ67977            6 SADPELLKSILEPLLEDFQYWFGRSLTFLESNELSFMTTEQQADLLARVVRAKQEVAAAQSLFRVTGGQVGVEISALTPW 85  Oscillator...
WP_015187005       86 HHLLTECWKVGMRFR 100 Gloeocapsa sp. PCC 7428
P73889             86 HNLVTECWQVAQRHR 100 Synechocystis sp. PCC 6803 substr. Kazusa
WP_015227364       85 HKLVTECWQVARQNR 99  Halothece sp. PCC 7418
WP_012306987       87 HQLVSECWQVAQKRR 101 unclassified Synechococcus
Q31M52             87 HALVTECWQIGARWR 101 Synechococcus elongatus PCC 7942
Q2JMF4             87 HRLLMKCAELGRQFR 101 Synechococcus sp. JA-2-3B'a(2-13)
CAK23203           87 HQLVMEVWALAAQVS 101 Synechococcus sp. WH 7803
WP_015164207       86 HQLLMECQAIAIRHR 100 Pseudanabaena sp. PCC 7367
jgi:Syn7502_00298  86 HNLMMECQSVGMRFR 100 Synechococcus sp. PCC 7502
EKQ67977           86 HHLVSECWQVVNRFR 100 Oscillatoriales cyanobacterium JSC-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap