2JD3


Conserved Protein Domain Family
Plasmid_stab_B

?
pfam10784: Plasmid_stab_B 
Click on image for an interactive view with Cn3D
Plasmid stability protein
This family is conserved in the Enterobacteriales. It is a putative plasmid stability protein in that it is expressed from the operon involved in stability, but its actual function has not yet been characterized.
Statistics
?
PSSM-Id: 119304
View PSSM: pfam10784
Aligned: 12 rows
Threshold Bit Score: 78.9234
Threshold Setting Gi: 363642981
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JD3_A                  8 KKYTLYLHPEK-AADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL 78 
wugsc:KPN_pKPN4p07095   4 GQYSFYLHSDD-RTDIAAMATISTISQPLRGEFIRTAATAGAVVYQVDARLPALIPVFFAGQLSAVRLCAVM 74  Klebsiella pne...
ACJ65286                5 RKCSFYIYPERnAADRVADGFLEKLPQKERGRAMRAMMLCGAALMKQDERLPFLIAEFLTESTSMQDIQRII 76  Klebsiella pne...
EZA31099                8 RRCSFELFPDErTGDKIADELIANEKLKERGRFMRAMLVTGAAFAAIDKRLPLLISELLTENTTLDDINKVI 79  Escherichia co...
ncbi:pSF07201_018       6 RTIAFKLNPDVnQTDKIVCDTLDSIPQGERSRLNRAALTAGLALYRQDPRTPFLLCELLTKETTFSDIVNIL 77  Shigella flexn...
Q8XBF8                  6 RRISFYLKPAAvKSEQEACNYLDSLPASERSRAQRAAFLAGLALIKRNPAFAYWMAEWPEDNLPFNTVSIKE 77  Escherichia co...
EIG80030                6 RRISFYLKPAAvKNEGKACAWLDSLTPEARKSGQRVAFLAGLALMKINPAEAYRLAAWADDEALSLTQTRTE 77  Escherichia co...
EZE10450                8 KKFTLYLHPEK-AADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL 78  Escherichia co...
tigr:EcE24377A_D0012    8 KKLSLYLHPED-SADCLALAEIETVPRKKRGELYRQALITGLIMHQLDERIPAVLTALFTRELNADEVISQI 78  Escherichia co...
WP_000445929           10 KKVVAYLHPALyPQDNLTQQTIDSLPVQMRGDFYRQSLICGAALYSVAPRLLTLISVFFSEKITAENLVKLI 81  Enterobacteria...
EHL82313                1 RRYTLTLQNG--RSGERVESVLTEASSRLRGDLLRNLIITGLALHTTAPELPRLLASMPVPPTSVSELQALV 70  Klebsiella sp....
WP_010895842           10 RKFTSYLQLDC-EADRRALDVVESISQRVRGDFLRNAIITTAALHQLDPRLPVLLATLYNGQLTSEQLVNLV 80  Serratia entom...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap