Conserved Protein Domain Family
DUF4226

?
pfam10774: DUF4226 
Domain of unknown function (DUF4226)
This family of mycobacterial proteins are uncharacterized.
Statistics
?
PSSM-Id: 402415
View PSSM: pfam10774
Aligned: 12 rows
Threshold Bit Score: 98.6161
Threshold Setting Gi: 81415040
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
goetting:NONO_c15980 245 RGSGKTAAQVRRNQLYQRNVAGAfnNLDNDLIDYMRSLDGKHTVDKNAVAQLLREVDIQLARIGPAA-YTKAGAQQVHRI 323 Nocardi...
CCF62148              27 PGSGGAASGSRAQQLFQRTAATAfnNLDNQLARYVTELAGNHQVDRTKLTQLIREVNGALATLGPHA-YTRAGHARVHQI 105 Nocardi...
WP_013830935           5 RGAFADAARARENKLVNRLAASA--AADHDFEAILREAVRNNSASRQRLDAMAAEIRQAAATWPGL--DTPAGSRQFQRY 80  Mycolic...
MSJTU:JDM601_0059      1 MGVFANAARAREAELTRRLATSV--ELDRSFQEILRGAHQFNAQSRQRLDALEAEIRQAAAAWPAL--NTPAGARQFQAY 76  Mycolic...
MSJTU:JDM601_2298      5 RGAHAETAQSREVSLIVRQQTAA--RTDDVLSTALRGAVDHAREGRRRLDTIGAEIRDALGDQRAPAsDTPAGVRQFQLF 82  Mycolic...
MSJTU:JDM601_0581      5 LGAHADAARDREAALATRLHTTT--QLDRAFVATLRGAAQVALRGRRRLDGIEAEIRQALANQQALAlDTPAGARQFQQF 82  Mycolic...
Q744U1                 5 PEYSLEAVEARRSALADQHGAAS--EADRVLAEVLASAHAAAQESARRLDASAEQIDRAVAHQADLAiDTPLGAREFHKF 82  Mycobac...
VBC:MMAR_0044         11 AGSALAAIRARQAELARQHDVLG--EADRALAEALTRAHTVMRDSVRRLDAIGAEIDGAVAGQDSLAlDTPLGAREFQNF 88  Mycobac...
P9WMA1                 5 AGSSVAVIQERQALLARQHDAVA--EADRELADVLASAHAAMRESVRRLDAIAAELDRAVPDQDQLAvDTPMGAREFQTF 82  Mycobac...
WP_013826985          54 QGSAVRAMRTAESALAQQLSATA--EFDRQIIAALRHAHKTTLEGRRRLDNVQTEIVGATQHWDL---STAAGAREFQRF 128 Mycolic...
P9WMB1                76 QGDAARAIADAEAALAHQNSATA--QLDLQVVSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDL--DTPAGARDFQRF 151 Mycobac...
Q744U0                83 SGAAADAIASAEAALAQQNSVSS--QLDMQVVTAILNAHLKAVDGREALTKLQQETEAAVRTRSDL--DTPAGARDFQRF 158 Mycobac...
goetting:NONO_c15980 324 LIKALLQATRIVTGSTGVSRSGAAEINRLTKQYVYNLA 361 Nocardia nova SH22a
CCF62148             106 LTAALQKAHTIVSAGQSTAKDMAAHVERLTAQYLWNIN 143 Nocardia cyriacigeorgica GUH-2
WP_013830935          81 LTGKAREIHKIVNDAHADSEHRAGLVRTLTNRYKLGGD 118 Mycolicibacter sinensis
MSJTU:JDM601_0059     77 LTGKTREIHKVVADAAADSQQRAAQVQALTGRYPLRGD 114 Mycolicibacter sinensis
MSJTU:JDM601_2298     83 LAAKARDIRRVVADVAADSRAGTALLRSLGSDYGVAAR 120 Mycolicibacter sinensis
MSJTU:JDM601_0581     83 LTVKTRDIHRVIADTVADSHARAAAVRSLGGGYTVKGP 120 Mycolicibacter sinensis
Q744U1                83 LLAKQHEIASVVTEAQELGRAKRVVLENLRAQYSAGNR 120 Mycobacterium avium subsp. paratuberculosis
VBC:MMAR_0044         89 LLAKQREIATIVATAHELDRTKSAVLASLRAHYGESAG 126 Mycobacterium marinum M
P9WMA1                83 LVAKQREIVAVVAAAHELDRAKSAVLKRLRAQYTEPAR 120 Mycobacterium tuberculosis H37Rv
WP_013826985         129 LIVKLGEIIGVVEEANDDDTSKQELTAALTALYAAPAA 166 Mycolicibacter sinensis
P9WMB1               152 LIGKLKDIREVVATASLDAASKSALMAAWTSLYDASKG 189 Mycobacterium tuberculosis H37Rv
Q744U0               159 LIGKLRDIRAVVLNASLDDTSKSALMAAWTSLYDAAKS 196 Mycobacterium avium subsp. paratuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap