Conserved Protein Domain Family
DUF2597

?
pfam10772: DUF2597 
Protein of unknown function (DUF2597)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402414
View PSSM: pfam10772
Aligned: 10 rows
Threshold Bit Score: 220.705
Threshold Setting Gi: 500708496
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012623892    9 KDFDITIGDLSLSVSQATLGITDNIEVAKDKGVPNGWVAGDVGAEGDMDLDALGVSILSEAAASAGSWRELPEFDMLFFA 88  Desulfovibrio ...
WP_014292202    8 MNFDVEILGVMLHVEKATLTINDSTAVTQTRGITDGYVDGDVTADVEYELDTKNFNLLSDAARRAGSWRGIDVHDALFYA 87  Oceanimonas sp...
WP_012883485    8 QSFDFNMDGALVHAEKVSLSITDNTAAAQTQGIPDGWVAGDVAAEGEMELSTKSLAVVTAKASSAGSWRGIEPVDLMWYA 87  Dickeya
WP_015871559    8 MSFDVNVGGIEIHINTVSLDISDETSVAKTRGIPDGTIDGAISAEGEIEVDSRNFNLLGEAASQAGSWRGLPPMDFLFFA 87  Edwardsiella i...
P51726          7 MSFDFYLFGLPIHAESISLSITDNSTVVQTRGIPDGWVSGDVAAEGEIELDAKNFSKLSAAAAAAGSYRSLPETDFTFFA 86  Haemophilus ph...
jgi:Daes_0455   7 KSFDINIGDMLVHVDKATLSITDNSAVAKDRGVPNGRVPGDVEAAGEVEVDATALNLIIEAARSAGSFRDLDTFDILFYA 86  Pseudodesulfov...
WP_014205470    8 KNMHFSLGDYKLKAQKVTLSITDNSAVNKTSGVPDGWVDGDVEASGEMELTTQQFNLLSKAASQSGSWRGLPDFDALFYG 87  Vibrio furnissii
Q2SPX5          9 KDIDVMIGDMLVHVEEVTLSIEDATAVTKTRGIPNGYVDGEVSASGDITVDTTNLQTILDAAKAAGSFRALEPFDQVFNG 88  Hahella chejue...
WP_011978409    6 KDFDTMIGDYSVRVESLSASITDNRKVIKENGIPVDFTNGDVECSGEIELNIRNFKLIAAAAKDAGSWRDLKPFDIGITG 85  Marinomonas sp...
Q15Y07          7 KDFDVMIGDLLVHIESFNATITDERTPVKSGGVPNGYVDGDCACSGDLELDSRNFNVLSEAAKSAGSWKGLEPFDINAIA 86  Pseudoalteromo...
WP_012623892   89 KAAsGEEMKVEAFGCKLKVESLLTINANeGASKHTTKVKFLVTSPDFVHINGVPYL 144 Desulfovibrio desulfuricans
WP_014292202   88 NTG-GEEFRVEAFGIKLQISDLLDIDGK-GGAKNVHKIKGFVTDPEFVRINGVPYL 141 Oceanimonas sp. GK1
WP_012883485   88 KAG-SEEMKVEAFGCKLILSDILDVDPK-GGSVMSHKIKFVVTSPDFVRINGIPYL 141 Dickeya
WP_015871559   88 DTG-DERIDVKAFGCKLLLSNLLNIDSK-GGELAMHKLKYLVSSPDFVHINGTRvl 141 Edwardsiella ictaluri
P51726         87 QRG-GIRDKVETFGNKIILTDVLNIDPK-GGAKSMKKLKYFVTSPDFVRINGVSYL 140 Haemophilus phage HP1c1
jgi:Daes_0455  87 NSGsGEELKVEAFGCAFKIESLLDIDSK-GGEKHITKLPFDVTSPDFIRINGVPYL 141 Pseudodesulfovibrio aespoeensis Aspo-2
WP_014205470   88 KID-NDELKVEAFGCRLKISDLLDIDTN-GGSALLHKLPFEVTSPDFININGVPYL 141 Vibrio furnissii
Q2SPX5         89 ATS-GGELRIEAFGCKLRISDLLNAKAS-GGEQLTHKLAYDVTDPDFVRINGVPYV 142 Hahella chejuensis KCTC 2396
WP_011978409   86 SVT-GENQTIDLDKCLLRISDLINIDPN-SNDQMKIKLPFDVTGPDFVVIDGTPYL 139 Marinomonas sp. MWYL1
Q15Y07         87 LTD-SAEMGVEMFGCMLKISDLLAIDPN-GKEKKKHKIGFDVTDKEFVRINGVPYL 140 Pseudoalteromonas atlantica T6c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap