Conserved Protein Domain Family
DUF2594

?
pfam10769: DUF2594 
Protein of unknown function (DUF2594)
This family of proteins with unknown function appear to be restricted to Enterobacteriaceae.
Statistics
?
PSSM-Id: 371234
View PSSM: pfam10769
Aligned: 12 rows
Threshold Bit Score: 109.834
Threshold Setting Gi: 115347594
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D361               1 MSNADFSTAASAETLAHEVTCLKAMVTLLLKAIGQADAGKVIINMERYIAQLEDAEQAAVFDNTIKQIKTSYRK 74  Pectobacterium ...
WP_013318562         1 MNNNDFPTAPTPETLAHEVSCLKVLMTLMLKSIGQADAGKVIVSMEKYIAQLEDPAEAEIFGTTIKQIKTVYRR 74  Dickeya dadantii
ADD76585             1 MSDEDFATSQETQKLSDEVACLKMMITLILKGMGQADAGKVIINMERYVKTLGDMPQAEVFSNTIKQIKAAYRQ 74  Pantoea ananati...
WP_013201598         1 MSNTDFSTSEETKTLSEEMACMKALVTFMLKGMGQADAGKVIINMEKYIDQLTDQQQADVFSSTIKQIKQAYRQ 74  Erwinia
WP_025245199         1 MGNVEFTTDSETAVLAQELNCMKAMMSLLLKAIGQADAGKVIIKMEKYISQLDDPEQQAVFTSTVKQITHAYRQ 74  tsetse S-endosy...
goetting:EBL_c15510  1 MSTPDFSTRENAAELALELSCMKALFTQMLKAMGQADAGKVIIKMEKEISQMENSNHAEAFTSTLKQIKQAYRQ 74  Shimwellia blat...
WP_012131931         1 MSTPDFSTAENNQELANEVTCLKAMLTLMLQAMGQADAGRVILKMEKQIAQIEDETQAAVFSSTVKQIKQAYRQ 74  Citrobacter
ACR69454             1 MSNVDFSTEATIEALTHEVTCLKATLTEMLKAMGQADAGKVIINMEKYAARIEDQEQSDAFKKTMAQIKHVYRQ 74  Edwardsiella ic...
CAL20504             1 MSNPDFTTSADPQILANEVACLKATLTLLLKAIGQADAGKVILNIERSIAGIEDAAQAEVFTNTLAQIKNGYRQ 74  Yersinia pestis...
Q7N5C5               1 MNKIDLIPSSDTETLATEVTCLKVLLASILKTMGQAHAGRVVLNLERVIAEMGDEKQAKIFENTVQQIKALYRQ 74  Photorhabdus la...
WP_012367999         3 EK---FKTQADVETLAQEVACLKTLVTYMLKALGQADAGRVILNIERAISEVADEQQAETFRNTLNQIKTAYRQ 73  Proteus
CCH:MU9_1955         3 NA---FKTENDTETLAAEVTCLKALVTYLLKAVGQADAGRIIVNMERQISEIDDEHLSGTFKNTIAQIKTEYRK 73  Morganella morg...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap