Conserved Protein Domain Family
DUF2583

?
pfam10762: DUF2583 
Protein of unknown function (DUF2583)
Some members in this family of proteins are annotated as YchH however currently no function is known.
Statistics
?
PSSM-Id: 402407
View PSSM: pfam10762
Aligned: 12 rows
Threshold Bit Score: 113.577
Threshold Setting Gi: 490357557
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004237330      1 MKRKLSLLLGNLLMVVGMLLMVGSMAFTVGVLIFALPLPDIYSEASLMGIFIGALVWLGGAGLSGrRESIADKYYWLRHF 80  Morganella
P0AB49            1 MKRKNASLLGNVLMGLGLVVMVVGVGYSILNQLPQFNMPQYFAHGAVLSIFVGAILWLAGARVGG-HEQVCDRYWWVRHY 79  Escherichia ...
WP_015870903      1 MKRKGAELLGNVLMGLGLITMVGGVGYSVLAQLPQLDLPQYFSHGAVMSIFIGALLWLVGARVGG-RERVADRYWWVRHY 79  Edwardsiella...
WP_015697399      1 MKRKTARIIGNGLMGLGLLTMVGGVGYSILNQMPELGLPQFLAHGAIGSIFIGAILWLAGARVGG-QERVADRYWWVRHF 79  Rahnella aqu...
CAX59353          2 MKRKHANLTGNSLMVFGLVVMVAGVGYSVLNQLPQLQLPQFMVHGAIFSIFIGALLWLVGARISG-REKVADRYYWVRHY 80  Erwinia bill...
utah:Sant_2117   16 MRRKSAMLVGNSLMGAGMILMVASIAVSVLNQLPQIHMPNLMASGGIMGIFVGALLWLAGARMGG-HEEISDRYWWHRRF 94  Sodalis prae...
Q6D556            1 MKRKNVAALGNVLMGLGMILMIGGIGFSIASQFPKLNVPEYMTYIDLVGIFSGAIFWLVGARISG-REEVADRYWWVKHF 79  Pectobacteri...
IEC:ABF-0015343   1 MKRRNAVMMGNVFMGLGMLLMIAGIAYSIANQLPELNLPGSLYYVELLAIFAGAILWLAGARISG-RENVTDRYWWLKHF 79  Dickeya dada...
WP_012988641      1 MKRKNAFILGNIFMGLGMAAMLISLSFVLLSHVFSLDQSGFATGISLMGLFVGALVWLAGASIGG-REQVSDKYWWLKNY 79  Xenorhabdus ...
CBJ90163         46 MKRKKAFIFGNILMGLGMAAMFISLAYVLLGHIFDLGLSELLMGIALMGLFVGALIWLAGASVGG-REQVTDKYWWLKHY 124 Xenorhabdus ...
Q7N591            1 MKRQSAFIVGNVLMGVGMFTIVSSLVYTLLPHIFGFGWPEFLSEAALLGVFIGALVWLAGAGVGG-REGVADRYWWLRNY 79  Photorhabdus...
CAR42335          1 MKYKHAFAVGNLLMAIGMVLMLGSLGYNLLSHIFPLGLPDILSDASLMGIFIGALVWLAGARIGG-RETVAERYWWLRNH 79  Proteus mira...
WP_004237330     81 HSRYRRR 87  Morganella
P0AB49           80 DKRCRRS 86  Escherichia coli K-12
WP_015870903     80 DKRCTRK 86  Edwardsiella ictaluri
WP_015697399     80 DSRCTNG 86  Rahnella aquatilis
CAX59353         81 DKRCRRS 87  Erwinia billingiae Eb661
utah:Sant_2117   95 DARCQKN 101 Sodalis praecaptivus
Q6D556           80 DKRCRRQ 86  Pectobacterium atrosepticum
IEC:ABF-0015343  80 DKRCRRE 86  Dickeya dadantii 3937
WP_012988641     80 DERYRRK 86  Xenorhabdus bovienii
CBJ90163        125 DERYRRK 131 Xenorhabdus nematophila ATCC 19061
Q7N591           80 DERYRRG 86  Photorhabdus laumondii subsp. laumondii
CAR42335         80 DERYRRH 86  Proteus mirabilis HI4320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap