Conserved Protein Domain Family
DUF2590

?
pfam10761: DUF2590 
Protein of unknown function (DUF2590)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402406
View PSSM: pfam10761
Aligned: 13 rows
Threshold Bit Score: 151.327
Threshold Setting Gi: 219867834
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Ddes_0254     8 DLLIVDDDISLDGGGYPVLVTDRPCIAQDILHMIRESGLLVELVGERDVRRRKTNLVKLTLMVDQDSRIKPGTTAIEEVW 87  Desulfovibri...
Q15XZ7           29 DLYITDDDLTLNSTGEPYLVSGRLAIAQDIKHMIRETGYVVRMIGERSSDLRQHYMKLIEIEMEEDRRLTPGTAKVTELS 108 Pseudoaltero...
WP_013513424      8 DLLITDDDITLDRGGIPERCRDRDSIAQDIKHMIRETGLLVELVGNRDARKKQENIIRLTIAVDNDERIVPGSCSIHEVS 87  Pseudodesulf...
Q72BJ4            6 DLRITDDDLTLDAGGQPVMLEGRASIAQDIVHMIRESGLLVDIIANRDARQRRTNIVRITIAVDDDKRIVPGSTAVEEAR 85  Desulfovibri...
WP_014205463      8 DMLIEAGDVVLDAGRNPVLIQDRAVIAQDIKHAIMESHLAVDLIAERSPSKKADIRTQLELLVEEDVRLVPGTVRLEEPA 87  Vibrio furni...
P51732            7 DLLITGEDITLDSGNQPLICDNRISIAQDIKHAILESGLATQLIAERSRILRRDIILQMVLLVEEDVRLIPGTVSISEER 86  Haemophilus ...
WP_014292195      9 DLLVEDGGLVLDAGAQPVTTDNRHSIGQDIKHAVLESGLARALIGERSPTLRADVRTQIRILVEQDTRLVPGTAEVREEA 88  Oceanimonas ...
WP_025422720      8 DLLIDRGDFALNAGNEPELCNNRQSIGQDIVHAILESGLATQLIAERSPTLRADIFTQLELLVESDERIVPGTVEVSEEG 87  Sodalis prae...
WP_015871564     10 DLLITDRNFTLNSGREPVLCDNLRSIAQDCQHAIIESGLATRMLAEKSPTLRADLMMQMMLLVEDDDRIVPGTVSVTEET 89  Edwardsiella...
IEC:ABF-0018441  14 DLLITERDFSLNAGREPIFCNNRISIGQDCVHAIIESGLTTKLVAERSPTLRADVLTQMIILVEDDERIIPGTVVVSEES 93  Dickeya dada...
CBJ80154         11 DLLITEGSFTLNSGNEPRFCHNRISIGQDCVHAIMESGLATELVAERSPTLRADIRTQIEILVEDDERIIPGTVIINEET 90  Xenorhabdus ...
WP_011978403      6 DLLITNDDFTLDANGEPRLIYDADCIAQDIKHLIRESGLMFEVIGQRDSLSVKYQMQKLTLLVEDDVRLVPGTINVTRVD 85  Marinomonas ...
Q2SPY2            6 DLHIVNNDISLDAIGVPQEISGRASIAQDIKHMIRDSGLLVELIGERNPEKVALNLSRIETRVENDARITPGTAKVTRTD 85  Hahella chej...
jgi:Ddes_0254    88 I--SrervEFWLTAETLAFGRISF 109 Desulfovibrio desulfuricans ATCC 27774
Q15XZ7          109 I--N----TLTVTANTVEYGPLNI 126 Pseudoalteromonas atlantica T6c
WP_013513424     88 L--G----TFYLVAETAEFGPIDF 105 Pseudodesulfovibrio aespoeensis
Q72BJ4           86 P--G----EYWLTAQTVDYGEITL 103 Desulfovibrio vulgaris str. Hildenborough
WP_014205463     88 D--G----TIYVFAKTAEFGNLDL 105 Vibrio furnissii
P51732           87 L--G----QLFITAETYEFGRLde 104 Haemophilus phage HP1c1
WP_014292195     89 A--D----RYLLTARTYEFGELEV 106 Oceanimonas sp. GK1
WP_025422720     88 Q--K----RLWVTANTYDFGTISY 105 Sodalis praecaptivus
WP_015871564     90 PlsG----RLLILAATEDFRHEPL 109 Edwardsiella ictaluri
IEC:ABF-0018441  94 P--T----RLWVTAETYDFGPITA 111 Dickeya dadantii 3937
CBJ80154         91 P--T----QLWITAETYDFGRLNV 108 Xenorhabdus bovienii SS-2004
WP_011978403     86 T--E----MFYITATTYKYGEIGF 103 Marinomonas sp. MWYL1
Q2SPY2           86 L--E----TFYITAKTLKYGHIEF 103 Hahella chejuensis KCTC 2396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap