Conserved Protein Domain Family
DUF2586

?
pfam10758: DUF2586 
Protein of unknown function (DUF2586)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402404
View PSSM: pfam10758
Aligned: 11 rows
Threshold Bit Score: 602.056
Threshold Setting Gi: 123171684
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACR69436              3 WPSVTITQLNTFGGVTRSIERTVLFVGTAS-MNY---EAIFPVIASSDLDAMFGSDDCVLKDEIAAFFKSAGPGAFCYAA 78  Edwardsi...
P51725                2 FPSVQINALNQLSGETKEIERHALFVGVGT-TNQ---GKLLALTPDSDFDKVFGETDTDLKKQVRAAMLNAGQNWFAHVY 77  Haemophi...
IBRC:GU3_08630        2 IPTIQVNNLNQMQGPTNEVERHFLFVGQAT-KNS---GKLLSINTQSNLDDLLGTEDSPLKTNLLAAMQNAGQNWSAHAH 77  Oceanimo...
jgi:Daes_0454         3 LGTVQVNKLNLLQGELADVERYFLFIGLGAgTNE---GKLLTVNTDTDLDDVLGAAASNLKTQVQAAKVNAGQNWFAAVL 79  Pseudode...
jgi:Ddes_0246         2 LGTVQVNNLNLIQGPLTAVENFLLFTGQGAgTNE---GKLISVNAQSDLDAVLGLESSNLKKQVAAAQLNAGQNWNAAVL 78  Desulfov...
JLExeter:vfu_A02511   3 TGKVQVNNLNLGQGGIPEIERHLLYIGRT--DKAelqGVVTRVNNMTDLDGVV--ADDALGANVIAAQLNGKQNWTAAIF 78  Vibrio f...
WP_011978410          3 VGKIAVNALNLMQGPFPTVEKYFLFIGVGA-TNV---DQILYLNTDSDLDAELGAADSELKRNVVAAKANAGQNWAAAAI 78  Marinomo...
Q2S7H8                3 QGKVTINNLNLSQGNFPEVERKALFIGVGA-KNL---GRVLSLNTQSNLDESLGADDSALKTNVAAAKANGGENWQAYAA 78  Hahella ...
Q15Y08                3 QGKVIVNALNLVQGSLPSVERHFLFIGNAP-EGV---DTVIALDQQSDLDVLLGEADSVLKTNIQAARLNGGEQWGATCV 78  Pseudoal...
WP_012987564          2 WPHVQVNQVNQLQGETKVIERVLLFVGAGK-THV---GKTLAVNTQTDFDAVLGTAQTALKRQVLAAMANAGQNWSGYVH 77  Xenorhab...
IEC:ABF-0018450       3 WPTVQVNQVNQLQGETSEIERVVLFIGEGA-VDA---VKTVPVNTQSDLDQVLGAADSVLKRDVSAAMVNAGQNWSAFVC 78  Dickeya ...
ACR69436             79 VISdfipfpapgEKRqpIWANTVRRAMAR-VSVEGVIITETIST-QEEILAAQALRTELNNTLGRWLWFALPVAGIDV-- 154 Edwardsi...
P51725               78 IAQ---------EDGy-DFVECVKKANQT-ASFEYCVNTRYLGVdKASIGKLQECYAELLAKFGRRTFFIQAVQGINHdq 146 Haemophi...
IBRC:GU3_08630       78 VLA---------LAE--DWTEAVLAAQQV-ASFEAVVLLEPVTT-AEQINAAQALRNQLIATWGRWQFMMLAAEGIKAdg 144 Oceanimo...
jgi:Daes_0454        80 PLA---------EGA--AWADAVDYAMER-TSVEAIVITDPVTA-AAEIEAMQAKAEEIMGQYMRPVIFIPTCAPIDP-- 144 Pseudode...
jgi:Ddes_0246        79 PLR---------DGD--TWQDAVDLAVEE-MQVEGICLTDPVSQ-AVEVERMQAKAETIMAKYMAPVFMAAAARPPL--- 142 Desulfov...
JLExeter:vfu_A02511  79 GLG---------ADD--TWQEAVDIANRT-DSFEGICLCDEVTT-SAEFGEMQAKATELTSKLGRWVFFLAACPGIDA-- 143 Vibrio f...
WP_011978410         79 PVA---------DGA--LWDAAVDFAMNNnIKVEAVVVCTPVTE-QAQLTAMHAKAMDLNTTYGRRAFFIAAARMIDGtp 146 Marinomo...
Q2S7H8               79 PIN---------SGD--PWEAALDQAMLT-VSPELVALCAPAAD-AAAIEAMQTKAELIRTTIGRRVIILTASAGVDA-- 143 Hahella ...
Q15Y08               79 PIT----------GA--DYGAGIDIAIAAgISPEAIVVLTPAAD-SAAVNALHTKAVELLNTHSRRVFILGVTAGIDA-- 143 Pseudoal...
WP_012987564         78 VLp--------eSADelAFVEAVIAAQTI-ASVEGYVLTVG-AT-KAIIKAAQTLRANTIAQFGRWQWAILAVDGTQ--- 143 Xenorhab...
IEC:ABF-0018450      79 LLp--------pKGD---WVSAVTAAQQV-ASVEGVVVSLP-AS-KNSIAQAASLRSALVSKFGRWVWFLLAIDGPK--- 141 Dickeya ...
ACR69436            155 -NNEIWAEYIEKLTALQQGIVAPQVQLVPTFFGNDIGVLAGRLCNAAVTVADSPARVATGPLQGLKNlDRPVDVDDNQLG 233 Edwardsi...
P51725              147 sDGETWDQYVQKLTTLQQTIVADHVCLVPLLFGNETGVLAGRLANRAVTVADSPARVQTGALVSLGSaNKPLDKDGNELT 226 Haemophi...
IBRC:GU3_08630      145 vDAQDWPAYETDMTALANGIAADGVMLVPQLHGNNAGVLAGRLCNRAVTVADTPMRVKTGALVGLG--PAPKDSTGAELS 222 Oceanimo...
jgi:Daes_0454       145 -ATEDWSAFTADRNALLTGLACDQVNPVASIWPDDQGAYCGRLCDAAVTIADTPMRVITGPVVGIRS-ARPVDSADREVD 222 Pseudode...
jgi:Ddes_0246       143 -ETETWEDYRSAISPITSGLVADQVTLTASMYGHELGTYMGRLCNKSVTVADSPIRVKTGSLLGEWS-VKPTDKDGRNLD 220 Desulfov...
JLExeter:vfu_A02511 144 -ESQTWSAYETAMLNLVKDVAANLVTPVPQLNGNNVGVLGGRLCDRSVTVADSPMRVATGDVLGLG--DMPVDSSNKPLE 220 Vibrio f...
WP_011978410        147 gTGESWSEYINDIKDLTETLSAFRVSIVPYIYDDAVGIYAGRLCNAQISVADTPMRVATGSIVGQDQsTLPTDKNGIIYS 226 Marinomo...
Q2S7H8              144 -ETQSWSDYEAAQAAITQGAACPRVAVVPQLHGNDLGVLVGRLCNRAVSIADSPMRVATGSVLGLG--DAPVDRDGVELP 220 Hahella ...
Q15Y08              144 -GTQSWSDYLTAQNAILDGVAGHRVAVVPQLHGNDVGVLAGRLQHAGVSIADTPMRVASGSVIGLG--NTPVDSDNVELG 220 Pseudoal...
WP_012987564        144 -SKEPWADYVTRLAELQKGEAVPSVQLVPCLWGHEAGVLAGRLCNRAVTVADSPARVQTGALMDLGAtDFPKDGAGQTLD 222 Xenorhab...
IEC:ABF-0018450     142 -EGEGWDKYLQSLSNLQNGAAAPAVQLVPRLWGNEPGVLAGRLCNRAVTIADSPARVQTGALLAMGRtDLPVDGTGVMLD 220 Dickeya ...
ACR69436            234 LATLQALARVRYSVPMWYADYEGLYWSDGVTLEAEGGDYGVIENVRVADKAARRIRIMAIPKIADRTLNSTPGSIAAHEM 313 Edwardsi...
P51725              227 LAHLKSLETARYSVPMWYPDYDGYYRADGRTLDVEGGDYQVIENLRVVDKVARKVRLLAIGKIADRSFNSTTSSTEYHKN 306 Haemophi...
IBRC:GU3_08630      223 LATLQTLEAARLSVPWWFPDFDGVYWADGNLLDVEGGDYQVVENRRVADKVARKLRIRGIARIGDRQLNSTPGSIAAAKL 302 Oceanimo...
jgi:Daes_0454       223 MSVLKAMDAARWTVPQWYPDYPGVYYGDGNVLDVPGGDYQVIEYLRVVHKAMRKVYPLAVAKIGDRKLNSTPASIAYHAS 302 Pseudode...
jgi:Ddes_0246       221 MATLYALDKARFSVPQWHPGYDGIYWGDGNVLDVNGGDYQVIENLRVVQKCMRRVYPLAVARIGDRTLNETPESIAAAQT 300 Desulfov...
JLExeter:vfu_A02511 221 MSTIATLADARYSLPQWYADLEGVYWSDATTLEAKGGDYQYLEYVRPVHKLNRRVRIKAIRRIADRILNSTPASIELNRT 300 Vibrio f...
WP_011978410        227 NAHAIALNNQRFSVPAFYADYEGVYWSDGQLLDAVGGDFTVVENLRVIDKAARMVRIILIQLIGDRRFNSTASGEAWAIR 306 Marinomo...
Q2S7H8              221 DATLATLDANRLSCVQRYPDYPGTYWGDCNLLDVPAGDYQVIENLRVVDKAARAIRILAIARVANRSLNSTPVSIAANKT 300 Hahella ...
Q15Y08              221 DAVLAALDQNRFSVPQHYVDYPGTYWGDCNLLDIPGGDYTVVENLRVVDKAARAVRLLAIARVGNRSLNSSAVSIANNKT 300 Pseudoal...
WP_012987564        223 LATLQALEKLRFSVPMWYPDYDGLYWSDGRTLDVEGGDYQSIENLRIVDKVARRVRLQAIAKIADRSLNSTPGSIATHQA 302 Xenorhab...
IEC:ABF-0018450     221 LAMLQALEKQRYSVPMWYPDYDGYYWSDGRTLDVEGGDYQAIENLRVVDKVARRIRLQAIAKIADRSLNSTPGSIAAHQG 300 Dickeya ...
ACR69436            314 LFGKPLREMAKSVQINGITFPGEVRPPKDGDVTITWPENSRVSINFIIRPYNCPKEITVGIMLD 377 Edwardsiella ictaluri 93...
P51725              307 YFAKPLRDMSKSATINGKDFPGECMPPKDDAITIVWQSKTKVTIYIKVRPYDCPKEITANIFLD 370 Haemophilus phage HP1c1
IBRC:GU3_08630      303 YFMRDLRVMSKSVTIAGITFPGEITPPDDGDIAIEWLSKYEVAIYALARPYDCPKKIGINIILD 366 Oceanimonas sp. GK1
jgi:Daes_0454       303 YFMRPLREMSRSVEILGVTFPGEVEPPKDGDISITWTTKTKVQIYMVVRPYNCPKEITCNIMLD 366 Pseudodesulfovibrio aesp...
jgi:Ddes_0246       301 YFARPLREMAKKRKILGVPFPGEIHPPAKDAITLVWLSKYELEVWITARPYNCPKAITCNLLLD 364 Desulfovibrio desulfuric...
JLExeter:vfu_A02511 301 YFRKDMRDMSKGMEIGGITFPGEIMVPRDSDVTIEWLTKTRVQIGLMVRPHNCPKEIAVNIALD 364 Vibrio furnissii NCTC 11218
WP_011978410        307 KLSRPLKNMSKSTEFNGMTFPAEIKPYQDGDIVINWITREKVEIYMVARPYSIPKDITANIMLD 370 Marinomonas sp. MWYL1
Q2S7H8              301 YFMRPLREMSKSVVFAGEHFPGEIKSPKDDSIEIVWPTKTRVEVYLKVQPYNCPKDITANIILD 364 Hahella chejuensis KCTC ...
Q15Y08              301 FFSRPLREMSSSTTFAGTHFPGEIEAPGDDAIQIVWVTRTRVQIWLKLTPVNCPKEITVNIALD 364 Pseudoalteromonas atlant...
WP_012987564        303 YFARTLREMSRSTEINGVTFPGEVKSPLDGDVAITWRNKNTVEIYITVRTYECPKGISVSLLLD 366 Xenorhabdus bovienii
IEC:ABF-0018450     301 YFAKTLREMSRSTQINGITFPGEVKPPKDGDVVIAWRSKTAVEIYLVVRTYECPKGITVSLVLD 364 Dickeya dadantii 3937
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap