Conserved Protein Domain Family
DUF2555

?
pfam10742: DUF2555 
Protein of unknown function (DUF2555)
This family is conserved in Cyanobacteria. The function is not known.
Statistics
?
PSSM-Id: 402395
View PSSM: pfam10742
Aligned: 35 rows
Threshold Bit Score: 83.0524
Threshold Setting Gi: 81710729
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Cyast_1562    8 DKDFATMTIEDVAEIATRLENDDYKTPFESLQDWHKLRAIAFHREDLIEPYFYLL 62  Cyanobacterium stanieri PCC 7202
Q8DG56           19 QEYINHLTPQDVAALARRLEEDDYDTPFAALEDWHLLRAIAFHRPELVEPYLYLL 73  Synechococcus elongatus
WP_012160816      8 NKNVSGFTEEDVALLAKRLEEDDYETPFAALEDWHLLRSIAFQRPELTESYLYLL 62  Acaryochloris marina
WP_012630172      7 hPDVTTLTETEVAQLAQRLEEDDYETPFAALEDWHLLRSLAFQRPELAEPYLYLL 61  Cyanothece sp. PCC 7425
jgi:Syn6312_1465  9 dpDLSAYTVADVSQLAQRLEEDDYETPFAALEDWHLLRALAFQRPELTQSYLYLL 63  Synechococcus sp. PCC 6312
Q7NLS7            9 TKTLADWTPQEVAELARRLENDDYEHAFDALADWQVLKALQYRRPQLVDAYVHLL 63  Gloeobacter violaceus
Q2JKQ5           15 GMDPRQFTEADVAAIAERLERNEYPTVFGCLEDWHALRAVAFYAPHLVAPYAHLL 69  Synechococcus sp. JA-2-3B'a(2-13)
jgi:GEI7407_2380  8 HKDVAEITEAEVAALANRLEDDDYSSVFEGLEDWHLLRAIAFQRPELVEPYIHLL 62  Geitlerinema sp. PCC 7407
CAK29101          9 EELLAAQTEASVAVLAQRLEDDDYASPFDGLGDWHLLRALAIHRPELVRPYVHLV 63  Synechococcus sp. RCC307
CAK22776          5 PERLASFDEASVASLARRLEDDDYPTPFAGLSDWHLLRALAIHRPELTRPYVHLI 59  Synechococcus sp. WH 7803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap