Conserved Protein Domain Family
DUF2527

?
pfam10736: DUF2527 
Protein of unknown function (DUF2627)
This family of proteins with unknown function appears to be restricted to a family of Enterobacterial proteins. It has a highly conserved sequence.
Statistics
?
PSSM-Id: 119256
View PSSM: pfam10736
Aligned: 2 rows
Threshold Bit Score: 53.9882
Threshold Setting Gi: 1518097655
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA231221:EGX74_13925  1 MCGIFSKEVLSKDVSVEYRFSADPYLSASSSNDSSLSM 38  Yersinia pestis
P64508                   1 MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSM 38  Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap