Conserved Protein Domain Family
DUF2515

?
pfam10720: DUF2515 
Protein of unknown function (DUF2515)
This family is conserved in Firmicutes. Several members are annotated as YppC. The function is not known.
Statistics
?
PSSM-Id: 371209
View PSSM: pfam10720
Aligned: 21 rows
Threshold Bit Score: 417.414
Threshold Setting Gi: 81786998
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015892061            36 VEQIKQETHAHNRDNIDRTRAYLSFYQKHPQVHWALLAHLVSRNAGWSMTDLRGELLPRLLRTKEQQDYFSFLERGNWLI 115 Brevi...
P39791                  13 LSRIERQTKMKNADNISRTNAYKAFYDRHPEIKWSLLASFVSRNAGWSMTDLKGSLFQLGLRERQQKWFFLAYERANWLI 92  Bacil...
Q65I69                  11 TSRIQELTAKLNKDNISRTNAYKRYFDRHPEIKWSLLASFVSRNAGWSMTDLKGRLFELGLTAFQQKWLFLAYERANWLI 90  Bacil...
PRJNA212797:N288_16825  17 AEEIRSIADHYNKDNISRTHAYFDYYQSHPDIQWAFLASMVSRNAGWNMCDLEEASLSCLLGPEIRERLFLTYERANWLI 96  Bacil...
Q8EQE6                  10 IHYITNSTSSHNIDNISRTKAYQAYYEKHPEIVWTLIATVVSRNAGYNMTDLTLSTYKKMLGREEIEYLFQTYERANWTI 89  Ocean...
Q9KC70                  10 IRVIREETDYFNTDNVSRTMAYQRFFQKYPEIRWAFLASMVSRNAGYHMTDLESKWFQFLLNPLMRKQLFLTYERANWAI 89  Bacil...
WP_012958550             8 lQLIKKTVEKHNKDNISRTKAYERFYERNPEIRWAMLAGIVSRNAGWNMTDLSSKWFQGILDKNSRATIFAMYERANWII 87  Bacil...
jgi:Bcell_1918          11 IKHVKEMTLRYNKDNLLRTKAYGDFFIRNNEIYWAYLASMVSRNAGWNMSDLWSRPYQVLLTKEQQNHLFTTYERANWLI 90  Bacil...
Q81FM5                  18 IHNIKKKTEIANVDNISRTQSYQEYYLRNSEIRWAFLASMVSRNAGWNMTDLEGRYYATVLPRTVKKHLFILYEQANWII 97  Bacil...
Q81SS1                  27 VYNIKKEIEIANMDNISRTQSYQDYYVRNSEIRWAFLASMVSRNAGWNMTDLKGRYYATVLPQTVKKHLFLTYEEANWII 106 Bacil...
WP_015892061           116 FHDAYPQLLLYEESVRRQTNLFYLLPHLGVSTFMQAIWNHFWKTTDKELLAIALIINEQNYLEEQLMKDSSYQNSVVRTI 195 Brevi...
P39791                  93 FSDAYPQLLLYHWSKRVGKPLFHLLHVFGVSQFMSEEWTRFWHERNTERLMYALIINEQNTIQTPIIQNPSFKKNVFDTI 172 Bacil...
Q65I69                  91 FSDAYPQLLLYHWSKQLGQPLFHLLSSFGVSSFMKTEWERFWHERDQKRLMYALIINEQNTIQTPIIQNPLFKKNVFQTI 170 Bacil...
PRJNA212797:N288_16825  97 FSDAFPQLLLYEYSTKKNSPMFHLLPFFHVSSFMEKEWNRFWQEGDRERLMIALIINEQNLIQRPVIEHPVYKRRVFHSL 176 Bacil...
Q8EQE6                  90 FSDAYPQLLVYELSKELQKPLFHLLVQFQVSRFMIKEWNYFWKTNNKERLMLALIINEQNVIEHPLITKSKYEKEVFHSL 169 Ocean...
Q9KC70                  90 FRDAYPQLMIYEWSKRWGQPFFHWLKEFQVSPFMMKEWRHFWRQGNMDRLCVALIINEQNVIQKPVIEEPSLKKAVFRRL 169 Bacil...
WP_012958550            88 FQDAYPQLLLYEWAKKKQLPVFEQLKTFHVSEFMRQEWEFFWEARDEVRLCTSLIINEQQLLELEVMSSGLFQKNVFHTL 167 Bacil...
jgi:Bcell_1918          91 FSDAFPQLLIYEWSKKLKEPLFYLLTYFKVSKWMINEWEAFWETGNKERLLQALIINEQNLIQRPVIEAPFFKREIFNSF 170 Bacil...
Q81FM5                  98 FLDAFPQLLLYEESKKRRAPLFHLLQYFNVSIFMEKEWLLFWERRDMNRLMTALIINEQNKIQKPVIENTYFKKHVFHTA 177 Bacil...
Q81SS1                 107 FLDAFPQLLLYEESKRRQVPLFHLLQYFNVSIFMEKEWIYFWEKKDINRLMTALIINEQNKIQKPIIENTYFKKHVFHTA 186 Bacil...
WP_015892061           196 PFALQELLQLNLILFPQRKvvdeqgsfLQLVGERVFHFASLPERIRLGKRLYSLLFGganRQEAAYAWAMEQPHTGSRKD 275 Brevi...
P39791                 173 PFYLSDWFHFNTVIFPSSN--------GFFYGISVKRFSKAEERIRLGKQLSQLLFKp-eLFSSFYHFLHTVPHTGSRFD 243 Bacil...
Q65I69                 171 PFQLCEWFHFNTVIFPTVE--------GVFYGVSVKRFTSLKERIKLGKQLSELLFSp-eLFPGFFHFTSCVPHTGSRFD 241 Bacil...
PRJNA212797:N288_16825 177 FFSIQDWMHFSSVLFPTCS--------GQLYGASVKKFRKTDERIMLGKRLAGILFSp-aHFPEFLNFAGKVPHTGSRLD 247 Bacil...
Q8EQE6                 170 PYHIINLLWMNAVLIPAIH--------QPSYGVFIHHFTSLNRRIKTGRQIATILSDp-kIYNRTIDFIRTVEPTGSRFE 240 Ocean...
Q9KC70                 170 PFYLQELGHFGHVLLPTKD--------GSLFGLYTRQFQKVDARIWLGKKLAGLLFHp-eVYSGVAAFAFSTEHTGSRCD 240 Bacil...
WP_012958550           168 RYQLEEYAHFSYVLLPTMN--------GSIYGQYVRNFTHVNQRIELGKRLAMILFHp-vVHKDILQFTRKVEHTGSRRD 238 Bacil...
jgi:Bcell_1918         171 SYVLQERLHFSSVLFPTKK--------GQIYGRTVKQFNKVEKRIQLGKELAWILFHs-rEKNDIHSFFNDVPFSGSRRD 241 Bacil...
Q81FM5                 178 LFKVQERLHISAVIFPTIE--------GRMYGFSVYQFETLQQRIELGKKLAWLLFHp-iYNGSFYKFALQTTHTGSRED 248 Bacil...
Q81SS1                 187 LFKLQEMLHVSAVIFPTVE--------GKMYGFSVYQFETLQKRVELGKKLAALLFHp-nYKSLFHRFALQTVHTGSRAD 257 Bacil...
WP_015892061           276 YWPHLFHdvndtvpgksyqvklmncqlrqGAKRLFSPTLRQVWRPIHHEPPKAL-DWY-KNKGDVWHVLTRMeETAFAAE 353 Brevi...
P39791                 244 MEKMIGI------------------------TKRTSPMLRTCYPELIHSLDGTKtDWF--HGKIKKTFFRRE-ELPKQIE 296 Bacil...
Q65I69                 242 MERWAGV------------------------KIRTSPFLRTCYPVVAHSLDGLKcDWF--RGGKREAMFKDE-KLPKTIE 294 Bacil...
PRJNA212797:N288_16825 248 YEQFLNG-----------------------GTKRALQTLKDTYPVISHHIHEKH-DWS-KERGVSPEWFAEEgETEEPVL 302 Bacil...
Q8EQE6                 241 YERFRKI----------------------NSKNEISLPYRQLYPIVQHQDNIRR-DWS-KKKGVHKKWLNRL-TVSQYSP 295 Ocean...
Q9KC70                 241 YLRYGSW-----------------------NSGNTSPLLRLTYPIISHQSATSS-RWN-ATVKDLNKWMAPI-GITKPID 294 Bacil...
WP_012958550           239 YERVCDI-----------------------TSPNTSPMLRVLHPVYHHKPPKGL-DWF-YSRKPLTPLFKRV-KETRPEE 292 Bacil...
jgi:Bcell_1918         242 YQKWQKG------------------------SFPFTPRMNDIYPYILHSDDKRE-DWSkSITYDPTNYIDKKmMKPMKYD 296 Bacil...
Q81FM5                 249 YEVYAKE-----------------------TRKSYTPTLRDIYPVILHEEIKMR-DWF-CANMKMNVLFVPE-EPKGEVN 302 Bacil...
Q81SS1                 258 YEQYIRE-----------------------ARKSCTPTLREVYPAVAHKEISMR-DWF-CRDMEINELFSRE-EYKGEVD 311 Bacil...
WP_015892061           354 MNEVYCQALAKIEWAVA 370 Brevibacillus brevis
P39791                 297 LTDWYLHKKRQLHALFA 313 Bacillus subtilis subsp. subtilis str. 168
Q65I69                 295 ITDWYFQKRRQLQALFS 311 Bacillus licheniformis DSM 13 = ATCC 14580
PRJNA212797:N288_16825 303 MTEWFLHKQRQLERAAG 319 Bacillus infantis NRRL B-14911
Q8EQE6                 296 IENQFNFKRKLLYLYGR 312 Oceanobacillus iheyensis
Q9KC70                 295 HMPWVKKKQTELFLLYS 311 Bacillus halodurans
WP_012958550           293 IREWVHTKRVELYWIYk 309 Bacillus pseudofirmus
jgi:Bcell_1918         297 LTGWYEHKQKQIVVTAS 313 Bacillus cellulosilyticus DSM 2522
Q81FM5                 303 ITEWYRRKREQIYRLSI 319 Bacillus cereus ATCC 14579
Q81SS1                 312 ITEWYKRKREQIYFASI 328 Bacillus anthracis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap