Conserved Protein Domain Family
NAD-GH

?
pfam10712: NAD-GH 
NAD-specific glutamate dehydrogenase
The members of this are annotated as being NAD-specific glutamate dehydrogenase encoded in antisense gene pair with DnaK-J.
Statistics
?
PSSM-Id: 402378
View PSSM: pfam10712
Aligned: 6 rows
Threshold Bit Score: 487.375
Threshold Setting Gi: 123499426
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
DSC:DSC_08695    42 ALHRRFQVGQRRLDPADHLAAHLRAMLGDGGAGGVDQGVGLVAHGHQFVELPVLVAVCFGVGDHALDLFVRQARTGL-DL 120 Pseudoxantho...
tigr:ACP_0796    78 AFERLLGVSQGGLHFGLLLTRNLVAVLLQHLLDVVDEVVELVAGLDLVALGLVFGRVRLGFLGHALHLFLAESRGGG-DG 156 Acidobacteri...
Q2INJ2           67 ALHGGAQAAHPLLDGGPLVGPEQLAVHRERGLERGEDPVALHPPLAQEALGHVLLGVLDALHQHVLDLFLGEAVGGL-HL 145 Anaeromyxoba...
wugsc:CKO_03372  72 TFQRRFQRAQCRLDSRFVVCWQLIARFFNLLTRAVQQMVALVTRLNQLFELTVRFCVRFSIANHFLNFVLVQTRRSL-DG 150 Citrobacter ...
EEQ38695         81 SLQ--------------------LLLLFVSLGESVVSVLE-----------------LLSVSNHLLNLVGGQSTDRVrDG 123 Clavispora l...
Q5P1H6           94 ALQRLFRVLHRLFDLFLLVGADLVAVFGQRFLHRMHQRVALVADIDQLVGLLVFLGVRRGVLHHALDLVLGQARVRL-DL 172 Aromatoleum ...
DSC:DSC_08695   121 DLLLLVGLLVLGRHVQDAVGVDVEGHLDLRQAARRRLDAGQVETGQRLVEAGLLALALQHVHGHGRLVVLGGGEGLRGLG 200 Pseudoxantho...
tigr:ACP_0796   157 DLLVLAGGRILRGHVQNAVGVDVKGDLDLRHAARRRRNAAQLELAQRAVLPGHGALALQHVYFDFGLAVTRRREGLRLLG 236 Acidobacteri...
Q2INJ2          146 DALLDAGGDLARRDLQDAVRVHGVGDLHPRDAGRHGRDALQREAGQRAAVAGQLALALHHVDHHAGLAVGVGGELLRGRG 225 Anaeromyxoba...
wugsc:CKO_03372 151 DLLLFTAVFVFRGNVQDTVSIDIKGDFDLRHTARRRVDAIQVELTQRFVIRRAFTLTLQHMDGYRRLVVFRGREHLAVLG 230 Citrobacter ...
EEQ38695        124 DVSRSAGRLLDGSDLQDTVSVNLEDSLQDWLTSGHWWDVLQVELTQQGVLRTVDTLTSVDWELNGGLVVSNSGESSSLDG 203 Clavispora l...
Q5P1H6          173 DLVLLAGRLVLRRDVQDAVRVDVERDLDLRHAARSGRDVGQVELAEALVAGGHFTFALQHVDRHRALVVVGRREHLARLR 252 Aromatoleum ...
DSC:DSC_08695   201 RDGGVLLDDLGEHPAQGLDAQRQRGHIQQQHVLD-----VTAQHAALDRGAQRHGLVGVDVLARLLA-EELGHRCLYLGH 274 Pseudoxantho...
tigr:ACP_0796   237 RDGRVARNHRRRHAAQRFDGQGQRRHVEQQQILD-----LTGQDARLHGRANRHHFIGVHAAMGLLA-KELLDDLLNAGH 310 Acidobacteri...
Q2INJ2          226 RDGGVAQDDLLDHPAHHLDAERERDDVEQQHVLAa----APVERVGLDGGAERHHGVRVEVGERLLA-EQRLHVPAHQRR 300 Anaeromyxoba...
wugsc:CKO_03372 231 RDSGVFADQRRHYAAHGFDTQRQRGNVQQQNVFH-----ITGQYAALHRCANSNSFVRVNVFTRFFT-KELRHFFLHHRH 304 Citrobacter ...
EEQ38695        204 WNSAVSWDNWSENVTLHGDTQRQWDDIQQQQVLGvlrggLTGQDSTLDSGTVSNSLIWVDGLLQLLTvEEVRQQLSDLWN 283 Clavispora l...
Q5P1H6          253 RHGGVLLDQLRHHAAERLDAERQRGHVEQQHVLD-----FALQHAALDRCADGNGFVRVHVAARFLA-EELLDLLLHLRH 326 Aromatoleum ...
DSC:DSC_08695   275 AGLAADQDHLADVAGAQAGVVERGAAGLDRLLDQVIDQRFQLGPGQLDVQVLGAGGVSGDVRQIDF--GLLR----GGQL 348 Pseudoxantho...
tigr:ACP_0796   311 AGLSAYQHHFVNLARVHTGIGHGLLAGLNGALQNVLDELLQLGAGQLLHQVLGAGCIGGDEGQVDL--GFKR----GRKL 384 Acidobacteri...
Q2INJ2          301 PRGPAHQHHPVHL--LDAGVAQRRPARDRGALHHRLDERLQLGAGQARPQAVAL-------RQLHL--GLDRlpvgERLA 369 Anaeromyxoba...
wugsc:CKO_03372 305 TRLTTNEDNVVDIRYGQASILQRDFQRLDGTVHQVFDQAFQFRASHFDVHVLRTGGICGDVRQVHV--GLLC----GRKL 378 Citrobacter ...
EEQ38695        284 SGGTTNQDNFVNTGLGDLSILQDLLNWVQGRLEQSRVNVLESSSGDVSGEVFTL------EQRVNFngGLGD----RRQS 353 Clavispora l...
Q5P1H6          327 PALAADQDHVVDVVDLQAGILQCDAARFDCALHQIFDERFEFGARDLHCEVLRTRRIGGDVGQVHF--GLLA----RRQF 400 Aromatoleum ...
DSC:DSC_08695   349 DLGALGGILQALQGQRIL--AQVDALVLVELVDQVVDDPGVEVFATQEGVAVGGQHLELLLAvdvgDLDDRHIEGAAAQV 426 Pseudoxantho...
tigr:ACP_0796   385 DLGALGGVLQALQGHFVAlgAQVEAFVLLELVDEPVHDLLVEVVAAQVCVAIGRLHLDDAFA----HFENGDVERTAAKV 460 Acidobacteri...
Q2INJ2          370 DL--LGGGHGPAQHRR----RGVRVRRGEPALEQRARHQPVEVVAAEVRVTDGGQHLEDALL----QPQDGHVERAAAQV 439 Anaeromyxoba...
wugsc:CKO_03372 379 DFRFFCRFFQTLHRQRVV--TQVNALIFLKFFNQVVDHTAVEVFTTQVGITVGCQNFEGFFAvnfvNFDNRDIESTTTEV 456 Citrobacter ...
EEQ38695        354 SLSTLTGSSQSSQSSGVT--RDVQTGLLLEVSLEEVQQVGVEILTTQVSVTSGSLDGENTTS----DVQQRNIESTSTQV 427 Clavispora l...
Q5P1H6          401 DLRLLGRFLQALQREHVL--LQVDALFLLELGDDVVDQALVEVLAAEESVAVRREHFELVFAvdvgDFDDGDIEGAAAEV 478 Aromatoleum ...
DSC:DSC_08695   427 IHGDLAVLRIa-lVQAIGQGRGGGLVDDALDVQACNPAGVLGRLTLAVVEVGRHGNHRLGDGLAQVGLGGLLHLLQHPRG 505 Pseudoxantho...
tigr:ACP_0796   461 IYGDGLVLLL---VEAIGQRGRGRLVDDALDVEPGNFAGVLGGLALRVVKVGRNRDDGLGHRGAQVVFGGLLELLQNHGR 537 Acidobacteri...
Q2INJ2          440 VHREHALRAL---VEAVRHRRRGRLVQQPQHVEPGEPARVLGGLALRVVEVRRHGDHAAARRAAQRLAGRAPQHPQDLRR 516 Anaeromyxoba...
wugsc:CKO_03372 457 VNRDSTVADFf--IQTISQRGGGRFVDDTFYFQTCDTTGIFRCLTLSIVEVSRHGDNSFSYRFAQVIFCGFLHFFQHFSR 534 Citrobacter ...
EEQ38695        428 EDQNVSLLLGltsTQTVSNSGGSWLVDDSQDVQTSNGTSVLGGLTLSVVKVSWNSDNSLLHLLTNLGLSNLLHLGQNHRG 507 Clavispora l...
Q5P1H6          479 INRDLRVARLl--VHAERERCGGRLVDDALDLEPCDAAGVLGRLALAVVEVGRHRDDGFGDFLAEVVLGSLLHLAQHFGG 556 Aromatoleum ...
DSC:DSC_08695   506 NFLRSHLLAVg---GGHPGVAVVMGhDAVGHQVQVLLDFGVgeLAPDQALDRIEGVLGVGDRLALGRGAHQHFAVLGIGD 582 Pseudoxantho...
tigr:ACP_0796   538 NFGGGVVLAL----RLDDDVVALLL-DLVGHHLHFVVHFIL--AAAHEALDGVNRVLRIGNRLALGHLAHQTLAALGKSH 610 Acidobacteri...
Q2INJ2          517 DLDRRDRALAaahpQADHRAGLVELvDA------AVLRPDVarAAAHEALHRQDRVHRPLGGAALGGPADLHAAFGRVEH 590 Anaeromyxoba...
wugsc:CKO_03372 535 DLRRCHFLTF----HIKPCVAVIGAdDFVRHDGNVTLNFFVleAAANQAFNRKQGVLRVCHCLTFSRLTNQSFTILGISN 610 Citrobacter ...
EEQ38695        508 NFLRGESLGLlqvlNFNQW-VTVGVdDLERPGLDVLLDRLVveSTTNQTLSIENSVLWVQSSSVLSSVTNQSFLS-GESN 585 Clavispora l...
Q5P1H6          557 DLRRGDFLAA----HFDPRVAVVGLaDRIGHQVDVLLYFLLfeAAADQALDGEQRVLRVRDRLALGRRAGQDLAVFRVRD 632 Aromatoleum ...
DSC:DSC_08695   583 DGRRGAVAFGIFDDAGLA-AFHDRHARVGRAEVDADDLAH 621 Pseudoxanthomonas spadix BD-a59
tigr:ACP_0796   611 HRRRGAAALFVGDHLRFA-AFHHGHHGIGGSEVNSNNLCH 649 Acidobacterium capsulatum ATCC 51196
Q2INJ2          591 RRREQRLALVHREDAGAVpLVHVGDERVGRAEVDPDRAGH 630 Anaeromyxobacter dehalogenans 2CP-C
wugsc:CKO_03372 611 DRRRGAIALGVLQHTCSC-AIHNRYTRVGSTQVDTNNFTH 649 Citrobacter koseri ATCC BAA-895
EEQ38695        586 EGRSNSVTSFVSNDFDSR-VV-SSNTRVGSTQIDTDSTse 623 Clavispora lusitaniae ATCC 42720
Q5P1H6          633 DGRGGTCAFGVFDDLGLA-AFHHGDAAIRRAQVDTDDFSH 671 Aromatoleum aromaticum EbN1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap