Conserved Protein Domain Family
DUF2512

?
pfam10710: DUF2512 
Protein of unknown function (DUF2512)
Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.
Statistics
?
PSSM-Id: 371204
View PSSM: pfam10710
Aligned: 19 rows
Threshold Bit Score: 108.526
Threshold Setting Gi: 504822954
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65IJ0         1 MKHVRALCLKFIVSLVLLYVVLTLFFGVPFGEMFVLTLFLGVISYLVGDLLLLPRTNNTTATMGDFGLSLVLIWVILAMQ 80  Bacillus lichen...
Q5KZ27         1 MKHIVPFVVKLAAWSVVLFSMFTIF-DAPLSLISLMTIVTALVSYMIGDLFVLPRVGHFVAAALDVPLSFLLIWPVSFAL 79  Geobacillus kau...
Q5WLD2         1 MKHSLLLLCKFIASFIAFTIGFFYFSEATFVDITTFALLVTVVSYIAGDLFVLPRFGNTIALVGDFLFTYLAVWIFGSVL 80  Bacillus clausi...
WP_014097832   1 MRNAIVLLAKFITCIVAFAVALDLFFDATITDILSFSLLVTIVSYVVGDVLLLPRIGNWKATVVDFLLVYASVWIFGNVV 80  Bacillus coagulans
Q81C37         1 MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNIL 80  Bacillus cereus...
Q8EP74         1 MKYIGAFFLKFLITLFTLWIVLGFIYGNLFSSIFLLSVIIATITYI-GDLFTLPRLSSQAAIISDFILYWIVLWLASITI 79  Oceanobacillus ...
O31816        31 MKHIIALASKIAFTLALLYVILDRVYHASFLSVMFIALFLGFVSYLSGDMLVLPRTNNITASLADFGLSFVILWVFVLTQ 110 Bacillus subtil...
WP_015010056   1 MAHIKLLSIKYAATLILLYLVLGIAYGISISQIIFVSL-ISLLIYYVGDIIILGRTNNFIATMFDLVANFVLIFSMLGLI 79  Amphibacillus x...
CCG43849       1 MEHLKLIAMKFLFTFPILLIILGGGFDVSFGNVFLISLVLTGVSYAVGDLLILSRSSNTTATISDFVFTFLVVYLMTDAL 80  Halobacillus ha...
WP_012958879   1 MEHVKALLIKAAATLVILYLILGLGLGMAFEYVLFITLVLGIGSYIAGDLIILPKTNNKIATGSDVGLAFIVVWLMGIPY 80  Bacillus pseudo...
Q65IJ0        81 NNPPYGtLAAASIVSAIGVTVFEYFFHRYMEANVLNetenGKRENREKPGSLQYQSESSE-E 141 Bacillus licheniformis DSM 13 = A...
Q5KZ27        80 IAPSVN-MAYGAFFSALAIGAVEAFFHLYMENHVHEe--aRREEAHRWYDEGRWATEFAE-E 137 Geobacillus kaustophilus
Q5WLD2        81 FHNYML-IAWGSILSAFVITIGEVFVHRYMLKHs-----rSVKSNESTQTRFAFNTEFG--E 134 Bacillus clausii KSM-K16
WP_014097832  81 LDNYLQ-IAWGSFIAACLISAAEVLVHRFLHHDAPS----AENTAKRQNQRLAYGTEMAE-E 136 Bacillus coagulans
Q81C37        81 LDNYMQ-IAWGSILSAIVFTLSEVIVHRFSNSHt-----rHNNDNIRINRRFAYGTEFAE-E 135 Bacillus cereus ATCC 14579
Q8EP74        80 INEVYS-ITIATLISAISLSLSEIYFHHYMLDDVIRq---KKMGEIAYFPTHRFQTETSE-E 136 Oceanobacillus iheyensis
O31816       111 TRNDFS-PFGAALLSAACLTVFEYFFHRYLLKNVLDe--nFRNELSARDNTLQYQTEAAD-E 168 Bacillus subtilis subsp. subtilis...
WP_015010056  80 KFGGD--QLIAAFISTIVLSFYEIFFHFYVVDEL------NLRQDNIFTSSYDYLTEFSS-E 132 Amphibacillus xylanus
CCG43849      81 TVGNN--VFSATLISTISLTIFEYFFHQSVARNLDG----EKAGTEKMSPAPQLSTEASE-E 135 Halobacillus halophilus DSM 2266
WP_012958879  81 GYSIGT-MAITAIIAAPVVGVFEFFFHTYISNKELG----------------RYGSGNRKwK 125 Bacillus pseudofirmus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap