4WQK


Conserved Protein Domain Family
Aminoglyc_resit

?
pfam10706: Aminoglyc_resit 
Aminoglycoside-2''-adenylyltransferase
This family is conserved in Bacteria. It confers resistance to kanamycin, gentamicin, and tobramycin. The protein is also produced by plasmids in various bacterial species and confers resistance to essentially all clinically available aminoglycosides except streptomycin, and it eliminates the synergism between aminoglycosides and cell-wall active agents.
Statistics
?
PSSM-Id: 402373
View PSSM: pfam10706
Aligned: 3 rows
Threshold Bit Score: 167.52
Threshold Setting Gi: 720063325
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WQK_A                  2 MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEI 81 
Q8YL66                  1 MNDLHIELIHQLFAASDKINLPLWLQGGWAIDAKLHRITREHEDIDIAYPGDRHAEFLCLLHAFGCVITEQTSYGFLAQS 80  Nostoc...
wugsc:KPN_pKPN5p08204  73 MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEI 152 Klebsi...
4WQK_A                 82 GDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLG 161
Q8YL66                 81 QGILLDCEPCVRIADDYELEGLPPGTCPLEPNGTLGGKLVRCTSWEAILWDYFYYLEEVPQSEWRPKDFHSFALAKDSFG 160 Nostoc...
wugsc:KPN_pKPN5p08204 153 GDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLG 232 Klebsi...
4WQK_A                162 AEKVEVLRAAFRSR 175
Q8YL66                161 EAATHNLHEQFKRL 174 Nostoc sp. PCC 7120
wugsc:KPN_pKPN5p08204 233 AEKVEVLRAAFRSR 246 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap