Conserved Protein Domain Family
MoaF

?
pfam10703: MoaF 
MoaF N-terminal domain
MoaF protein is essential for the production of the monoamine-inducible 30kDa protein in Klebsiella. It is necessary for reconstituting organoautotrophic growth in Ralstonia eutropha. It is conserved in Proteobacteria and some lower eukaryotes. The operon regulating the Moa genes is responsible for molybdenum cofactor biosynthesis. This entry corresponds to the N-terminal domain.
Statistics
?
PSSM-Id: 402371
View PSSM: pfam10703
Aligned: 24 rows
Threshold Bit Score: 90.0367
Threshold Setting Gi: 374657342
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q63LZ7               5 PVFIQVGALAEGFapDSHILAPVDDLAGRTLALAATHG--ATRE-YTfAGRSTLRWRErqaardidgpardtsDTRDARG 81  Burkholde...
tigr:AAur_pTC20086   7 PEFISVGALGEGFavNNNILEVHEGLNGRDFTLNFPSG--RTHD-CRiLDSNTLVWDG---------------------R 62  Paenarthr...
EHR52175             3 ESFIPVGTLGEGFapGANVLEETTDLTGQTLTLRLDTQ--ITLR----IGDGVASWGE--------------------HT 56  Saccharom...
WP_015452178         9 SEWIPVGALGDAFlpENNCLPPISDLAGRSFTLYFEDG--WIIE-HRfIDGDRLSWRLie------------gESDSRQG 73  Azoarcus ...
WP_013583755        12 RTWLPLDGLAPGF--DAAKAELTVALAGRTFTTVDESGtrTEYR----FGADAVEWTS-----------------TSENG 68  Microbact...
tigr:AAur_2546      43 SNWLPLDGLAPGF--DANKAPTVQDLAGKKFSVRNDGGp-MTFS----FDDEEVQWAA-----------------AGHSG 98  Paenarthr...
WP_015101099        12 STWLPLDGLAPGF--DENKAPTVGDLHGREVALDGPDGplLTAR----FTGTRIEWDH---------------------G 64  Saccharot...
WP_016333934        10 STWLPLDGLAPGF--DANKAPTVGDLHGRTFELACEDGttFTAA----FSGTRIDWTY------------------HGKG 65  Amycolato...
UANL:O3I_022320     15 AGWKGMDDFAAGI--DGNRIPPTDRLTDQCWSLRRSDEehTELRf---RSADQVRWTR-----------------GTESG 72  Nocardia ...
Q63YY7               6 QDWKNYEDFAAGI--DTNRLPATDALVGRALTFELPGG----AFaANfVDGQTLSWRR-----------------GETGG 62  Burkholde...
Q63LZ7              82 EAAYRATQLREGVYFVDYVDPARRATSVSLVLDLRRGVWTSVEGVLPA 129 Burkholderia pseudomallei
tigr:AAur_pTC20086  63 KQEARVTSVRKGIYFVDFLAGESVKESVSLVLDDTIGQVTLVEGSLPD 110 Paenarthrobacter aurescens TC1
EHR52175            57 DVPVRITSIRPGVYLVDGIADE---VSTTFVLDVDAAAVTVVEGRLPD 101 Saccharomonospora marina XMU15
WP_015452178        74 DERYVATRLREDIYFVDFIKCGERATTVSLVMDLRRNVFIAVIGELPV 121 Azoarcus sp. KH32C
WP_013583755        69 RDAVEVIEVDEELYYAQYTPAAHPDEAVTLILDLRSGHALTVISTLGT 116 Microbacterium testaceum
tigr:AAur_2546      99 TAPYEAFLVAEGLYYAQWQSQTDPEIAVSLVLDLLHGRALYIGAALGR 146 Paenarthrobacter aurescens TC1
WP_015101099        65 VDDCETFLVDDGLYYTQIHPKARPQEAVSLFLDLRDGRALVVTTTIGE 112 Saccharothrix espanaensis
WP_016333934        66 TDRCETFLVDDDLYYVQFHPQARQDEAFTLLLDLRRGRALLVLSKIGD 113 Amycolatopsis
UANL:O3I_022320     73 ADWYQAIEVSPDVFFLDQTFADRPHVSEVTVVHLPTARTVTIESTIAA 120 Nocardia brasiliensis ATCC 700358
Q63YY7              63 TDWYEAIEVAPDTFFVDVTFKSRPAEALTLVFNTATRRALGILSRIRS 110 Burkholderia pseudomallei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap