Conserved Protein Domain Family
DUF2499

?
pfam10693: DUF2499 
Protein of unknown function (DUF2499)
Members of this family are found in plants, lower eukaryotes, and bacteria and the chloroplast where it is annotated as Ycf49 or Ycf49-like. The function is not known though several members are annotated as putative membrane proteins.
Statistics
?
PSSM-Id: 402365
View PSSM: pfam10693
Aligned: 54 rows
Threshold Bit Score: 91.4833
Threshold Setting Gi: 81664525
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015169586       4 LSLPTWIIHISSVLEWVIAIWLIWNHSKMQPQvaKEWKGLALGMVPALVSAMCACTWHFFDNSIYLDWLVTVQAATTLIG 83  Synechococc...
XP_001418538       3 LSLPTWAVHVSSVTEWALAMKYVAGHADRTGN--ASWRNLTVAMSPFLASGITACTFHAFYNPASINALVPLQALLTLMG 80  Ostreococcu...
jgi:MICPUN_60549 287 LSVPTWAVHVSSVTEWALAMRLIYAFADVSGN--KNWRNVSVAMTPFLASGFCACTFHLFYNSPGVNALVPLQALLTLLG 364 Micromonas ...
jgi:Ctha_0606      3 LSIPTWIVHISSMAEWGMAIFLLYRYGKIIHR--SDVRQFALLMIPHWAGGLCVLAFHTTGDS--VSFLLDASKVINFFG 78  Chloroherpe...
Q3ANT1             3 LSLPNWIIHISSSLEWGIGAALLFHYGQLTER--RDIRTFALAMLPHWIGSFCVLAYHISGDT--IPLLLDMSELINLVG 78  Chlorobium ...
WP_011743955      14 LSLPNWIIHLSSTLEWGIAALMMFRYGMITGR--KDIRMFGISMLPHWVGSFFIIAYHLTGDS--IPLLLDLSETVNLFG 89  Chlorobium ...
jgi:Cphamn1_0022   3 LSLPNWLIHISSSLEWGIASLMMYRYGTMIGR--QDVQRFGLFMIPHWIGSWFVLAYHVSGDQ--VPVLLDLSETVNLFG 78  Chlorobium ...
Q8KAA9             3 LSPLNWLIHLSSSLEWGVALVMLYRYGQFIGR--KDVRRFALFMLPHWIGSWFVLLYHLSGDA--IMRFLEISEAINLVG 78  Chlorobacul...
ESQ15302           3 LSLPTWIIHLLTVSEWFAAILFIHRYGSRAQR--PQLRWFAYAMIPHLCAGLMLLGFHASSDR--ILGLLNASRLASVLG 78  uncultured ...
jgi:Thivi_3420     3 LSWPTWLIHLFTVTEWLVAMRLFWRYGTLIQR--REPRVFAVCMTPHLLGGILILLFHLSGDT--QRWLLELARVMTFGG 78  Thiocystis ...
WP_015169586      84 NCTLAIAGY 92  Synechococcus sp. PCC 7502
XP_001418538      81 NTGCAVAAY 89  Ostreococcus lucimarinus CCE9901
jgi:MICPUN_60549 365 NCACGVAAW 373 Micromonas commoda
jgi:Ctha_0606     79 STSLLYASL 87  Chloroherpeton thalassium ATCC 35110
Q3ANT1            79 STALLWATY 87  Chlorobium chlorochromatii CaD3
WP_011743955      90 SAALLYAVL 98  Chlorobium phaeobacteroides
jgi:Cphamn1_0022  79 SMALLYASL 87  Chlorobium phaeobacteroides BS1
Q8KAA9            79 SIALLYATL 87  Chlorobaculum tepidum
ESQ15302          79 SLALFSVTl 87  uncultured Thiohalocapsa sp. PB-PSB1
jgi:Thivi_3420    79 SLSLLAATL 87  Thiocystis violascens DSM 198
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap