Conserved Protein Domain Family
Phage_TAC_8

?
pfam10666: Phage_TAC_8 
Phage tail assembly chaperone protein Gp14 ()A118
This phage protein family is expressed from within a cluster of tail- and base plate-producing genes. It is a family of tail assembly chaperone proteins.
Statistics
?
PSSM-Id: 402344
View PSSM: pfam10666
Aligned: 2 rows
Threshold Bit Score: 228.482
Threshold Setting Gi: 81507754
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y4Z0   1 MAQNNVINIQLEESYQEFQLGTELFRVGLGDEMRRKWIEADEKYKKKLEKLNKYNIDNTDEMSSEDYFALEEDVKEALTE 80  Listeria monocytogenes
Q8Y4Z0   1 MAQNNVINIQLEESYQEFQLGTELFRVGLGDEMRRKWIEADEKYKKKLEKLNKYNIDNTDEMSSEDYFALEEDVKEALTE 80  Listeria monocytogenes
Q8Y4Z0  81 AYAVLLDDEEAFSKCYKQCKDILKMYQVYDQVAESIVGSVEKQQNEIQKKYKAKMTKKAK 140 Listeria monocytogenes
Q8Y4Z0  81 AYAVLLDDEEAFSKCYKQCKDILKMYQVYDQVAESIVGSVEKQQNEIQKKYKAKMTKKAK 140 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap