Conserved Protein Domain Family
PduV-EutP

?
pfam10662: PduV-EutP 
Ethanolamine utilisation - propanediol utilisation
Members of this family function in ethanolamine and propanediol degradation pathways. PduV may be involved in the association of the bacterial microcompartments (BMCs) to filaments.
Statistics
?
PSSM-Id: 402341
View PSSM: pfam10662
Aligned: 15 rows
Threshold Bit Score: 202.511
Threshold Setting Gi: 501052139
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003669166      1 MKRTMFIGAIACGKTTLTQRLENQQIKYNKTQAIEFSSNIIDTPGEYMEHHNMMSTLRVTSMDADIVVLLQSAVDKRLVF 80  Lactobacillu...
EDK35418          1 MRKIILFGRSGCGKTTLTQALRGQDIVYHKTQYINHYDAVIDTPGEYAENRSLGSALAIYSYEADVVGLLLSAIEPYSIF 80  Clostridium ...
Q9XDM6            1 MKRLMFIGPSQCGKTSLTQSLRGEALHYKKTQAIEWSPMAIDTPGEYLENRCLYSALLTSACEADVIALVLNADAQWSPF 80  Salmonella e...
wugsc:KPN_03221   1 MKRLMLIGPSQCGKTSLTQVLRGETLRYQKTQAIVWTPAAIDTPGEYLENRCLYSALLTSVCEADVIALVLNADAPWSPF 80  Klebsiella p...
WP_011836561      1 MKKIMFVGPVGVGKTTLTQRLKGLELSYFKTQAIEFYDAIIDTPGEFLQHRKYYNALNVTATEADVIGLLVAASNQMQTF 80  Streptococcu...
Q834L1            1 MKRIILMGAIGCGKTTLCQALQGKELIYDKTQAVEFHTEMIDTPGEFILHRQYYNALNVTAAEADVIGLVQSAVETQQVF 80  Enterococcus...
jgi:Clos_0792     1 MKKIMLIGSVGSGKTTLCQRIQGESIKYKKTQSVEFYSQMIDTPGEFVLHRRFYSALQMMAASSDVIGFVCSVVESGQTF 80  Alkaliphilus...
Q187L9            1 MKNIIFMGKTGSGKTTLCQKLDQLELKYKKTQSVELYNNAIDTPGEYMENRNLYNALITTSADAKIIAIVYDATQEENYI 80  Clostridioid...
jgi:Cphy_2648     3 SGKIIFMGRTGSGKTTLCQKLDALELKYKKTQSVELYDNAIDTPGEYMENRNFYRALIMTAVDAKLIAILGDPTVRDNYI 82  Lachnoclostr...
Q24MI7            3 DSKILLIGGVGTGKTTLKQALSDLPLIYQKTQALNFSEVFIDCPGEYLEIPRYYHVIIDLSHQVSEIWALQDATKTYLTY 82  Desulfitobac...
WP_003669166     81 PAGFCSMFSKPTLGVVTKIDLVkdPADIEYSKNLLLSAGVKKV-IPVSAVENINIDKL 137 Lactobacillus reuteri
EDK35418         81 PPNIAPCVNREVVGIVTQIDRS--DANANQAEYWLKLAGCKTI-FRVSSYTREGIGKV 135 Clostridium kluyveri DSM 555
Q9XDM6           81 SPGFTAPMNRPTIGLVTKADLAe-PQRISLVAEWLTQAGAQQI-FITSALNNSGLDAV 136 Salmonella enterica subsp. enteric...
wugsc:KPN_03221  81 SPGFTAPMNRPVIGVITKADLAa-PPRLQQVRTWLETAGAGHI-FITSALTGDGLDDL 136 Klebsiella pneumoniae subsp. pneum...
WP_011836561     81 PQGFSSLFNKEVIGIVTKIDMAdkEEQIEKARRQLKAAGAKEI-FEISATENEGIDRL 137 Streptococcus sanguinis
Q834L1           81 SPGFGSIFPKEIIGILTKIDLAqdSQQLEIVRQQLKSAGATRI-FEISSVEKIGLQEL 137 Enterococcus faecalis
jgi:Clos_0792    81 SPYFAQNFTKQCVGIITKIDLApnEEAIINAEKRLELAGVSKI-FRLSAMKDEGVAEL 137 Alkaliphilus oremlandii OhILAs
Q187L9           81 APGFASMFCKDVIGIITKINKAt-ENEVNIAYERLSLAGASQI-FKIDTVDNIGLEKL 136 Clostridioides difficile 630
jgi:Cphy_2648    83 PPAFAGTFAKEIIGIVTKVSIAgsEEDIKRVELELRQAGAQKI-FRVDTVEEIGIEEL 139 Lachnoclostridium phytofermentans ...
Q24MI7           83 PPKFVRVFRKPVIGVITKIDLP--QANLEAARSFLNNAGIAQPfYEISALHKKNIQIL 138 Desulfitobacterium hafniense Y51
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap